Dataset for protein Bcl-w of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3WPT2_BCL2L2-02      ----------------MATPASAPDTRALVADFVGYKLRQKGYACGTGPG
G3WPT2_BCL2L2-01      HSSSPIFFSLPFIASQMATPASAPDTRALVADFVGYKLRQKGYACGTGPG
                                      **********************************

G3WPT2_BCL2L2-02      EGPTNEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
G3WPT2_BCL2L2-01      EGPTNEPLHRAMRAAGDEFESRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
                      **************************************************

G3WPT2_BCL2L2-02      ELFQGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETQL
G3WPT2_BCL2L2-01      ELFQGGANWGRLVAFFVFGAALCAESVNKEMEPLVGQEKRYGVHLKQGIL
                      ************************************* : : *   :  *

G3WPT2_BCL2L2-02      ADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALV
G3WPT2_BCL2L2-01      ARYLPSKAGAAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALV
                      * :: *..* ****************************************

G3WPT2_BCL2L2-02      TVGAFFASK
G3WPT2_BCL2L2-01      TVGAFFASK
                      *********

© 1998-2019