Dataset for protein Bcl-2 of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3WZW9_BCL2-02      PFGCSPWCSLLSPLGIMAHPGRRGYDNREIVMKYIHYKLSQRGYD---------------
G3WZW9_BCL2-01      ----------------MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLP
                                    ****************************:               

G3WZW9_BCL2-02      ---------------------------------------------------VAAGPAVSP
G3WZW9_BCL2-01      PVVASAPAVGIFSNQPRHTPLPAAPQDLATSTTAAARNSPLPPPPAVAAATVAAGPAVSP
                                                                       *********

G3WZW9_BCL2-02      VPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIV
G3WZW9_BCL2-01      VPPVVHLTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIV
                    ************************************************************

G3WZW9_BCL2-02      AFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGW------VGVSA--
G3WZW9_BCL2-01      AFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHNWIQDNGGWGTKAICMGTSGPF
                    ***********************************************      :*.*.  

G3WZW9_BCL2-02      ---
G3WZW9_BCL2-01      QVS
                       

© 1998-2019