Dataset for protein BCL-2-like of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q0KFR9_MCL1-01        MSLSNSITRATTTMLHFQNGGSSYLADDARPLYYFQGAGAICAGASPKSK
B5XAY3_BCL2L1-01      -----------------------MMTYNNRELVVYYITYKLSQRDYPFNH
C0HAD8_BCL2L1-01      ------------------------MSYSNRELVVFFISYRLSQRNYSCCQ
                                              :: . * *  :  :  :.    .  :

Q0KFR9_MCL1-01        VDLGNGTGDTPPRPTTLGVNVVKSNGLDNHLSDRSNNDDSLPCTPQMASE
B5XAY3_BCL2L1-01      MELTEAQNRTEVGQVEGGAAVLTY--VNGTSPGTPPPRQSPPSSPRRTAG
C0HAD8_BCL2L1-01      LGLEGASGRTEGDDAIANGSV-----------GNSRSNLAKPSSPQ--GG
                      : *  . . *    .  .  *           . .    : *.:*.  . 

Q0KFR9_MCL1-01        CGPELSNCPSGDEVLEHDTRQLIENFLGDYTGLSQPRWTQSKPLTTMKRV
B5XAY3_BCL2L1-01      LDAVKE---------------------------------------ALRDS
C0HAD8_BCL2L1-01      MEPVKA---------------------------------------ALRDS
                        .                                          ::.  

Q0KFR9_MCL1-01        VEDVIAKHRYAYNGMVAKLDLDDRCDDMGVINSVAKTMFSDGITNWGRIA
B5XAY3_BCL2L1-01      ANEFELRYARAFSDLSSQLHITP-STAYQSFENVMDEVFRDGV-NWGRVV
C0HAD8_BCL2L1-01      VDEFELRYTRAFSDLSSQLHITP-ATAYHSFESVMDEVFRDGV-NWGRVV
                      .::.  .:  *:..: ::* :   .     ::.* . :* **: ****:.

Q0KFR9_MCL1-01        SLVAFGAVVSQHLKERGRGHCVELVGQEIAKYLLSDQSDWLIKNNAWNGF
B5XAY3_BCL2L1-01      GLFSFGGALCVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRF
C0HAD8_BCL2L1-01      GLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRF
                      .*.:**..:.    :.  .  *  : : :: ** .  . *: .:..*: *

Q0KFR9_MCL1-01        VEFFHV-------QDPESSVRNTLLAFAGVAG--IGATLAMFIR
B5XAY3_BCL2L1-01      AEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
C0HAD8_BCL2L1-01      AEIFGRDAAADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
                      .*:*         .. **  .. * ..  ::*  :*: :     

© 1998-2019