Dataset for protein Bcl-xL of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B5XAY3_BCL2L1-01      MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLT
C0HAD8_BCL2L1-01      -MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDDAIANGSV--
                       *:*.******::*:*.****:*.  :: *  *..*** .:. ...:*  

B5XAY3_BCL2L1-01      YVNGTSPGTPPPRQSPPSSPRRTAGLDAVKEALRDSANEFELRYARAFSD
C0HAD8_BCL2L1-01      -------GNSRSNLAKPSSPQ--GGMEPVKAALRDSVDEFELRYTRAFSD
                             *.. .. : ****.  .*::.** *****.:******:*****

B5XAY3_BCL2L1-01      LSSQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFSFGGALCVECVDK
C0HAD8_BCL2L1-01      LSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEK
                      *********:***:***.*******************:**********:*

B5XAY3_BCL2L1-01      EMNPLVGRITDWMTVYLDNHIQPWIQSQGGWDRFAEIFGMDAAAESRKSQ
C0HAD8_BCL2L1-01      DMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAEIFGRDAAADVRRSQ
                      :*.***.**:****.************************ ****: *.**

B5XAY3_BCL2L1-01      ESFKKWLLAGMTLVTGVVVGSLFAQKRL
C0HAD8_BCL2L1-01      ESIIKWLLVGVILLSGVLVGTLIMKKRQ
                      **: ****.*: *::**:**:*: :** 

© 1998-2019