Dataset for protein BCL-2-like of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5Y3_MCL1-02      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6V5Y3_MCL1-01      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6TIT7_BCL2L10      ------------MADPLQQRTEQLVADYLEY-------------------
A0A2K6UEL3_BCL2-01      ----------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDV
A0A2K6UWY8_BCL2L1-      ----------------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENR
A0A2K6TM77_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCG-----AGPG
A0A2K6V5Y3_MCL1-03      -------------------MFGLQRNAVIGLNLYCGGAGLG-----AGSG
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGP--------
A0A2K6TLM0_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGP--------
A0A2K6TLM0_BCL2A1-      ------------MTDHEFGYIHNLTQDYLRYVLQIPQSGTGP--------
                                                                          

A0A2K6TM77_BCL2L2-      EGPAA---------------------------------------------
A0A2K6TM77_BCL2L2-      EG-PAA--------------------------------------------
A0A2K6V5Y3_MCL1-02      GATPPG--------------------------------------------
A0A2K6V5Y3_MCL1-01      GATPPG--------------------------------------------
A0A2K6TIT7_BCL2L10      ----------------CSREPGTPESPPA---------------------
A0A2K6UEL3_BCL2-01      GAAPPGAAP---APGIFSSQPGHTPGPAAPRDPVARTXXXXXXXXXXXXX
A0A2K6UWY8_BCL2L1-      TEAPEGTDSEMETPSAINGNPAWHLADSPAVNGATGHSSSLDAREVIPM-
A0A2K6TM77_BCL2L2-      ------------------------EGPAA---------------------
A0A2K6V5Y3_MCL1-03      GATPPGGRL--LATGAKDTKPMGRSGAAS---------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLH-VTPGSAQQRFT
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLH-VTPGSAQQRFT
A0A2K6V5Y3_MCL1-02      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAG-ASPPAALT---
A0A2K6V5Y3_MCL1-01      --------GRLLAAEKEASAQREVGGGEAGAVIGGSAG-ASPPAALT---
A0A2K6TIT7_BCL2L10      --------TAEAAVLRATAAVVRKLYPSFFSAYRG-----YPRNRVELVA
A0A2K6UEL3_BCL2-01      XXXXSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH-LTPFTARGRFA
A0A2K6UWY8_BCL2L1-      --------AAIKQALREAGDEFELRYRRAFSDLTSQLH-ITPGTAYQSFE
A0A2K6TM77_BCL2L2-      --------DPLHQAMRAAGDEFETRFRRTFSDLAAQLH-VTPGSAQQRFT
A0A2K6V5Y3_MCL1-03      --------RKALETLRRVGDGVQRNHETAFQGMLRKLD-IKNEDDVKSLS
A0A2K6UWY8_BCL2L1-      -------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFE
A0A2K6TLM0_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
A0A2K6TLM0_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
A0A2K6TLM0_BCL2A1-      --------SKTSRVLQKVAFSVQKEVEESLKPCLDNVHIVSMDNARTIFS
                                       . ..                               

A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAFFVFGAALC------------------AE
A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAFFVFGAALC------------------AE
A0A2K6V5Y3_MCL1-02      -------------PDARRVVRPPPIGAEV---------------------
A0A2K6V5Y3_MCL1-01      -------------PDARRVVRPPPIGAEV---------------------
A0A2K6TIT7_BCL2L10      RMAEALLSDSPG-PTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLK
A0A2K6UEL3_BCL2-01      TVVEELFRD--G-VNWGRIVAFFEFGGVMC------------------VE
A0A2K6UWY8_BCL2L1-      QVVNELFRD--G-VNWGRIVAFFSFGGALC------------------VE
A0A2K6TM77_BCL2L2-      QVSDELFQG--G-PNWGRLVAFFVFGAALC------------------AE
A0A2K6V5Y3_MCL1-03      RVMVHVFSD--GVTNWGRIVTLISFGAFVA------------------KH
A0A2K6UWY8_BCL2L1-      QVVNELFRD--G-VNWGRIVAFFSFGGALC------------------VE
A0A2K6TLM0_BCL2A1-      QVMEKEFED--GIINWGRIVTIFAFEGILI------------------KK
A0A2K6TLM0_BCL2A1-      QVMEKEFED--GIINWGRIVTIFAFEGILI------------------KK
A0A2K6TLM0_BCL2A1-      QVMEKEFED--GIINWGRIVTIFAFEGILI------------------KK
                                         .:*    : . :                     

A0A2K6TM77_BCL2L2-      SVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWAE----------
A0A2K6TM77_BCL2L2-      SVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREM
A0A2K6V5Y3_MCL1-02      -------PDVT---ATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEDEL
A0A2K6V5Y3_MCL1-01      -------PDVT---ATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEDEL
A0A2K6TIT7_BCL2L10      EPEGDVARDCQ---RLVGLLSSRLVGQHRAWLEAQGGWVSTRRRTWGGMG
A0A2K6UEL3_BCL2-01      SVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWDA----------
A0A2K6UWY8_BCL2L1-      SVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWDT----------
A0A2K6TM77_BCL2L2-      SVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWAE----------
A0A2K6V5Y3_MCL1-03      LKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGWDG----------
A0A2K6UWY8_BCL2L1-      SVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW------------
A0A2K6TLM0_BCL2A1-      LLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWENGFVKKFEPKS
A0A2K6TLM0_BCL2A1-      LLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGWGK----------
A0A2K6TLM0_BCL2A1-      LLRERIAPDVDTYKEISYFVAEFIMNNTGEWIRRNGGW------------
                                           :           :    .             

A0A2K6TM77_BCL2L2-      ------------FTA---LYGDGALEEA---RRLREGNWASVRTVLTGAV
A0A2K6TM77_BCL2L2-      EEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV
A0A2K6V5Y3_MCL1-02      D-----------------GYEPEPLGKRPAVLPLLE---------LVGEP
A0A2K6V5Y3_MCL1-01      D-----------------GYEPEPLGKRPAVLPLLE---------LVGEP
A0A2K6TIT7_BCL2L10      TWEGPARWGIFLLCL---LNDLLLAGMEKTAGPGFPVMVVNSSIHLLLDT
A0A2K6UEL3_BCL2-01      ------------FVE---LYGPSM-------RPLFDFSWLSLKTLLSLAL
A0A2K6UWY8_BCL2L1-      ------------FVE---LYGNNAAAESRKGQERFN------RWFLTGMT
A0A2K6TM77_BCL2L2-      ------------FTA---LYGDGALEEA---RRLREGNWASVRTVLTGAV
A0A2K6V5Y3_MCL1-03      ------------FVE---FFHVEDL----------EGGIRNVLLAFAGVA
A0A2K6UWY8_BCL2L1-      --DT--------FVE---LYGNNAAAESRKGQERFNRWFLTGMTVAGV--
A0A2K6TLM0_BCL2A1-      GWMT--------FLE---VTGKICEMLSLLKQYY----------------
A0A2K6TLM0_BCL2A1-      -WNS--------LML---MLVESAQKKKKMAL------------------
A0A2K6TLM0_BCL2A1-      ----------------------------DLSQ------------------
                                                                          

A0A2K6TM77_BCL2L2-      ALGAL----------------------------VTVGAFFASK-------
A0A2K6TM77_BCL2L2-      DYGAT-----------AEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K6V5Y3_MCL1-02      GHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAKDT
A0A2K6V5Y3_MCL1-01      GHGSSTDGSLPSTPPPAEEEEDELYR----QSLEIISRYLREQATGAKDT
A0A2K6TIT7_BCL2L10      IIRSF----------------------------KIFSPLLPAQL------
A0A2K6UEL3_BCL2-01      -VGAC----------------------------ITLGAYLGHK-------
A0A2K6UWY8_BCL2L1-      -VAGV----------------------------VLLGSLFSRK-------
A0A2K6TM77_BCL2L2-      ALGAL----------------------------VTVGAFFASK-------
A0A2K6V5Y3_MCL1-03      GVGA--------------------------------GLAYLIR-------
A0A2K6UWY8_BCL2L1-      ---------------------------------VLLGSLFSRK-------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQV------IPKRT
A0A2K6V5Y3_MCL1-02      KPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV-----------
A0A2K6V5Y3_MCL1-01      KPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      NRPGISTTDRGFPRA-------------RYRARTTNYNSSRSRFYSGFNS
A0A2K6V5Y3_MCL1-02      ------LPCRGSRRW---------------------HQKCAAGFCRCC--
A0A2K6V5Y3_MCL1-01      SRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITD
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      RPRGRVYRGRARATSWYSPY------------------------------
A0A2K6V5Y3_MCL1-02      --------W---SRSWFGISNKIAL-------------------------
A0A2K6V5Y3_MCL1-01      VLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLA
A0A2K6TIT7_BCL2L10      --------------------------------------------------
A0A2K6UEL3_BCL2-01      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6V5Y3_MCL1-03      --------------------------------------------------
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
A0A2K6TLM0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6TM77_BCL2L2-      ----
A0A2K6TM77_BCL2L2-      ----
A0A2K6V5Y3_MCL1-02      ----
A0A2K6V5Y3_MCL1-01      YLIR
A0A2K6TIT7_BCL2L10      ----
A0A2K6UEL3_BCL2-01      ----
A0A2K6UWY8_BCL2L1-      ----
A0A2K6TM77_BCL2L2-      ----
A0A2K6V5Y3_MCL1-03      ----
A0A2K6UWY8_BCL2L1-      ----
A0A2K6TLM0_BCL2A1-      ----
A0A2K6TLM0_BCL2A1-      ----
A0A2K6TLM0_BCL2A1-      ----
                            

© 1998-2019