Dataset for protein Bcl-w of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TM77_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAA
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAA
A0A2K6TM77_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAA
                                   ***************************************

A0A2K6TM77_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG
A0A2K6TM77_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG
A0A2K6TM77_BCL2L2-      DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG
                        **************************************************

A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
A0A2K6TM77_BCL2L2-      GPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIH
                        **************************************************

A0A2K6TM77_BCL2L2-      SSGGWA-EFTALYGDGALEEARRLRE---------------GNWASV---
A0A2K6TM77_BCL2L2-      SSGGWA-EFTALYGDGALEEARRLRE---------------GNWASV---
A0A2K6TM77_BCL2L2-      SSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMS
                        *****  *          *** .*.*               ** ..*   

A0A2K6TM77_BCL2L2-      ---------RTVLTGAVALGALVT--------------------------
A0A2K6TM77_BCL2L2-      ---------RTVLTGAVALGALVT--------------------------
A0A2K6TM77_BCL2L2-      IEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHP
                                 *:: .* *  ** .                           

A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      --------------------------------------------------
A0A2K6TM77_BCL2L2-      KGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQVIPKRT
                                                                          

A0A2K6TM77_BCL2L2-      -------------------------------------------------V
A0A2K6TM77_BCL2L2-      -------------------------------------------------V
A0A2K6TM77_BCL2L2-      NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA
                                                                         .

A0A2K6TM77_BCL2L2-      GAFFASK
A0A2K6TM77_BCL2L2-      GAFFASK
A0A2K6TM77_BCL2L2-      TSWYSPY
                         ::::. 

© 1998-2019