Dataset for protein Bcl-xL of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6UWY8_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSA
A0A2K6UWY8_BCL2L1-      --------------------------------------------------
                                                                          

A0A2K6UWY8_BCL2L1-      INGNPAWHLADSPAVNGATGHSSSLDAREVIPMAAIKQALREAGDEFELR
A0A2K6UWY8_BCL2L1-      -----MWKRTGLRPQKGLI-------------------------------
                              *: :.  . :*                                 

A0A2K6UWY8_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2K6UWY8_BCL2L1-      -RRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                         **  . :.* ***************************************

A0A2K6UWY8_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2K6UWY8_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        **************************************************

A0A2K6UWY8_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K6UWY8_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2019