Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6RW46_BCL2L2-      -MATPASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6PPL1_MCL1-02      -----------------MFGFKRNAVIGLNLY------------------
A0A2K6PPL1_MCL1-01      -----------------MFGFKRNAVIGLNLY------------------
A0A2K6PHG5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYV----LQ----------------------
A0A2K6PHG5_BCL2A1-      --MTDCEFGYIYRLAQDYLQYV----LQ----------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYK----LSQKGYSWSQFSDVEENRTEAPE-
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYK----LSQKGYSWSQFSDVEENRTEAPE-
A0A2K6RW46_BCL2L2-      MATP-ASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6RW46_BCL2L2-      MATP-ASAPDTRALVADFLGYK----LRQKGY------------------
A0A2K6PPL1_MCL1-03      -----MFGFKRNAVIGLNLYC-------------GGAGLGAGSGGATPPG
A0A2K6R5T5_BCL2L10      MADPLRERTER--LLADYL-------------------------------
A0A2K6R2I6_BCL2-01      MAHAGRTGYDNREIVMKYIHYK----LSQRGYEWDAGDVGAATPGAAPAP
A0A2K6R2I6_BCL2-02      MAHAGRTGYDNREIVMKYIHYK----LSQRGYEWDAGDVGAATPGAAPAP
                                                                          

A0A2K6RW46_BCL2L2-      --------------------------------VCGAGPGEGP-AADPLHQ
A0A2K6PPL1_MCL1-02      --------------------------------CGGAGLGAGSGGATPPGG
A0A2K6PPL1_MCL1-01      --------------------------------CGGAGLGAGSGGATPPGG
A0A2K6PHG5_BCL2A1-      --------------------------------IPQPGSGPSK-TSRVLQK
A0A2K6PHG5_BCL2A1-      --------------------------------IPQPGSGPSK-TSRVLQK
A0A2K6QFA2_BCL2L1-      ----------------MWKRTGLRPQKG----------------------
A0A2K6QFA2_BCL2L1-      GTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVI-PMAAVKQ
A0A2K6QFA2_BCL2L1-      GTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVI-PMAAVKQ
A0A2K6RW46_BCL2L2-      --------------------------------VCGAGPGEGP-AADPLHQ
A0A2K6RW46_BCL2L2-      --------------------------------VCGAGPGEGP-AADPLHQ
A0A2K6PPL1_MCL1-03      GRLLATGAKDTKPMGRSGATSRKALET-----------------------
A0A2K6R5T5_BCL2L10      GCCAREPG---------------TPEPRPSTPEAAV--------------
A0A2K6R2I6_BCL2-01      GIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSP-VPPVVHL
A0A2K6R2I6_BCL2-02      GIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSP-VPPVVHL
                                                                          

A0A2K6RW46_BCL2L2-      AMRAAGDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQVSDELFQGG
A0A2K6PPL1_MCL1-02      RLLATEKEASARREIGGGEA----GTVIGESAGASPP-------------
A0A2K6PPL1_MCL1-01      RLLATEKEASARREIGGGEA----GTVIGESAGASPP-------------
A0A2K6PHG5_BCL2A1-      VAFSVQKEVEKNLKPCLDNV-------NVASIDTARTLFNQVMEKEFEDG
A0A2K6PHG5_BCL2A1-      VAFSVQKEVEKNLKPCLDNV-------NVASIDTARTLFNQVMEKEFEDG
A0A2K6QFA2_BCL2L1-      --------LNRRWRPPVPSM----ATH----PGTAYQSFEQVVNELFRDG
A0A2K6QFA2_BCL2L1-      ALREAGDEFELRYRRAFSDL----TSQLHITPGTAYQSFEQVVNELFRDG
A0A2K6QFA2_BCL2L1-      ALREAGDEFELRYRRAFSDL----TSQLHITPGTAYQSFEQVVNELFRDG
A0A2K6RW46_BCL2L2-      AMRAAGDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQVSDELFQGG
A0A2K6RW46_BCL2L2-      AMRAAGDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQVSDELFQGG
A0A2K6PPL1_MCL1-03      -LRRVGDGVQRNHETAFQGM----LRKLDIKNEDDVKSLSRVMVHVFSDG
A0A2K6R5T5_BCL2L10      -LRSAAARLRQLHRSFFSAYLGYPGNRVELVALMAEAVLSD------SPG
A0A2K6R2I6_BCL2-01      TLRQAGDDFSRRYRRDFAEM----SSQLHLTPFTARGRFATVVEELFRDG
A0A2K6R2I6_BCL2-02      TLRQAGDDFSRRYRRDFAEM----SSQLHLTPFTARGRFATVVEELFRDG
                                                                          

A0A2K6RW46_BCL2L2-      P-NWGRLVAFFVFGAALC------------------AESVNKEMEPLVG-
A0A2K6PPL1_MCL1-02      --------------AALT------------------PDARRVARPPPIG-
A0A2K6PPL1_MCL1-01      --------------AALT------------------PDARRVARPPPIG-
A0A2K6PHG5_BCL2A1-      IINWGRIVTIFAFEGILI------------------KKLLRQQIAPDVDT
A0A2K6PHG5_BCL2A1-      IINWGRIVTIFAFEGILI------------------KKLLRQQIAPDVDT
A0A2K6QFA2_BCL2L1-      V-NWGRIVAFFSFGGALC------------------VESVDKEMQVLVS-
A0A2K6QFA2_BCL2L1-      V-NWGRIVAFFSFGGALC------------------VESVDKEMQVLVS-
A0A2K6QFA2_BCL2L1-      V-NWGRIVAFFSFGGALC------------------VESVDKEMQVLVS-
A0A2K6RW46_BCL2L2-      P-NWGRLVAFFVFGAALC------------------AESVNKEMEPLVG-
A0A2K6RW46_BCL2L2-      P-NWGRLVAFFVFGAALC------------------AESVNKEMEPLVG-
A0A2K6PPL1_MCL1-03      VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IE-
A0A2K6R5T5_BCL2L10      P-TWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEVARDCQ-
A0A2K6R2I6_BCL2-01      V-NWGRIVAFFEFGGVMC------------------VESVNREMSPLVD-
A0A2K6R2I6_BCL2-02      V-NWGRIVAFFEFGGVMC------------------VESVNREMSPLVD-
                                      . :                    .            

A0A2K6RW46_BCL2L2-      --QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQ
A0A2K6PPL1_MCL1-02      -------------AEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIM
A0A2K6PPL1_MCL1-01      -------------AEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIM
A0A2K6PHG5_BCL2A1-      YKEISYFVAEFIMNNTGEWIRQNGGWGK----------------------
A0A2K6PHG5_BCL2A1-      YKEISYFVAEFIMNNTGEWIRQNGGWENG---------------------
A0A2K6QFA2_BCL2L1-      --RIAAWMATYLNDHLEPWIQENGGWDTF---------------------
A0A2K6QFA2_BCL2L1-      --RIAAWMATYLNDHLEPWIQENGGWDTF---------------------
A0A2K6QFA2_BCL2L1-      --RIAAWMATYLNDHLEPWIQENGGWDTF---------------------
A0A2K6RW46_BCL2L2-      --QVQEWMVAYLETRLADWIHSSGGWAEF---------------------
A0A2K6RW46_BCL2L2-      --QVQEWMVAYLETRLADWIHSSGGWAEF---------------------
A0A2K6PPL1_MCL1-03      --PLAESITDVLVRTKRDWLVKQRGWDGF---------------------
A0A2K6R5T5_BCL2L10      --RLVALLSSRLTGQHRAWLQAQGGWVST---------------------
A0A2K6R2I6_BCL2-01      --NIALWMTEYLNRHLHTWIQDNGGWDAF---------------------
A0A2K6R2I6_BCL2-02      --NIALWMTEYLNRHLHTWIQDNGGWRTM---------------------
                                                                          

A0A2K6RW46_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV--DYGATAEEL
A0A2K6PPL1_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSLPSTPPPAEEE
A0A2K6PPL1_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSLPSTPPPAEEE
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
                                                                          

A0A2K6RW46_BCL2L2-      EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALD-----
A0A2K6PPL1_MCL1-02      EDELYR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRV
A0A2K6PPL1_MCL1-01      EDELYR----QSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRV
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
                                                                          

A0A2K6RW46_BCL2L2-      --------ESLFRGRQIKV-------------------------------
A0A2K6PPL1_MCL1-02      GDGVQRNHETAFQGWVCGV-----------------LPCRGPRRW-----
A0A2K6PPL1_MCL1-01      GDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVT
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6PHG5_BCL2A1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6RW46_BCL2L2-      --------------------------------------------------
A0A2K6PPL1_MCL1-03      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I6_BCL2-01      --------------------------------------------------
A0A2K6R2I6_BCL2-02      --------------------------------------------------
                                                                          

A0A2K6RW46_BCL2L2-      -------IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF-------
A0A2K6PPL1_MCL1-02      ----------------HQKCAAGFCRCCW---S------RSWF-------
A0A2K6PPL1_MCL1-01      LISFGAFVAKHLKTINQESCIEPLAESIT---DVLVRTKRDWLVKQRGWD
A0A2K6PHG5_BCL2A1-      ----------------------------WH--------------------
A0A2K6PHG5_BCL2A1-      -------F-----------VKKFEPKSGWM--------------------
A0A2K6QFA2_BCL2L1-      -------VELYGNNAAAESRKGQERFNRWF--------------------
A0A2K6QFA2_BCL2L1-      -------VELYGNNAAAESRKGQERFNRWF--------------------
A0A2K6QFA2_BCL2L1-      -------VELYGNNAAAESRKGQERFNRWF--------------------
A0A2K6RW46_BCL2L2-      -------TALYG--DGALEEARRLREGNWA--------------------
A0A2K6RW46_BCL2L2-      -------TALYG--DGALEEARRLREGNWA--------------------
A0A2K6PPL1_MCL1-03      -------VEFFHVE------------------------------------
A0A2K6R5T5_BCL2L10      -------RRTPGRGAGRASGKRPRGRHGWLLSLLQDPLSAGFLEKTADPG
A0A2K6R2I6_BCL2-01      -------VELYG------PSMRPLFDFSWL--------------------
A0A2K6R2I6_BCL2-02      -------C-------------------TWC--------------------
                                                                          

A0A2K6RW46_BCL2L2-      ---------------------YSGFNSRPRGRVYRSG
A0A2K6PPL1_MCL1-02      --------------------------GISNKIALL--
A0A2K6PPL1_MCL1-01      GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K6PHG5_BCL2A1-      ---------------NHMPM---LVESVAHKKKKMAL
A0A2K6PHG5_BCL2A1-      ---------------TFLEVTGKICEMLSLLKQYC--
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLLGSLFSRK----
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLLGSLFSRK----
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLLGSLFSRK----
A0A2K6RW46_BCL2L2-      --------SVRTVLTGAVALGALVTVGAFFASK----
A0A2K6RW46_BCL2L2-      --------SVRTVLTGAVALGALVTVGAFFASK----
A0A2K6PPL1_MCL1-03      --------DLEGGIRNVL-LAFAGVAGVGAGLAYLIR
A0A2K6R5T5_BCL2L10      FPGMLVNNSLRLPLDTII-MSFKIFNPLLPAQL----
A0A2K6R2I6_BCL2-01      --------SLKTLLSLAL-VGACITLGAYLGHK----
A0A2K6R2I6_BCL2-02      --------RFR-------------------GCD----
                                                             

© 1998-2019