Dataset for protein BCL-2-like of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6PHF2_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQ--------------------------
A0A2K6PHF2_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQ--------------------------
A0A2K6PPI3_MCL1-02      -----MFGFKRNAVIGLNLYC---------GGAGLGAGSGGATPPGGRLL
A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYKLRQKGY----------------------
A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYKLRQKGY----------------------
A0A2K6RW35_BCL2L2-      -MATPASAPDTRALVADFLGYKLRQKGY----------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A2K6QFA2_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A2K6PPI3_MCL1-03      -----MFGFKRNAVIGLNLYC---------GGAGLGAGSGGATPPGGRLL
A0A2K6R5T5_BCL2L10      MADPLRERTER--LLADYL---------------------------GCCA
A0A2K6R2I5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
A0A2K6R2I5_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
                                                                          

A0A2K6PHF2_BCL2A1-      ----------------------------IPQPGSGPSKTSRVLQKVAFSV
A0A2K6PHF2_BCL2A1-      ----------------------------IPQPGSGPSKTSRVLQKVAFSV
A0A2K6PPI3_MCL1-02      AT---------EKEASARREIGGGEAGTVIGESAGASPPAALTPDARRVA
A0A2K6RW35_BCL2L2-      ----------------------------VCGAGPGEGPAADPLHQAMRAA
A0A2K6RW35_BCL2L2-      ----------------------------VCGAGPGEGPAADPLHQAMRAA
A0A2K6RW35_BCL2L2-      ----------------------------VCGAGPGEGPAADPLHQAMRAA
A0A2K6QFA2_BCL2L1-      -----------MWKRTGLRPQKG---------------------------
A0A2K6QFA2_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQA-LREA
A0A2K6QFA2_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQA-LREA
A0A2K6PPI3_MCL1-03      ATGAKDTKPMGRSGATSRKALET-----------------------LRRV
A0A2K6R5T5_BCL2L10      REPG---------------TPEPRPSTPEAAV--------------LRSA
A0A2K6R2I5_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQA
A0A2K6R2I5_BCL2-02      SQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQA
                                                                          

A0A2K6PHF2_BCL2A1-      QKEVEKNLKPCLDNV-------NVASIDTARTLFNQV-----------ME
A0A2K6PHF2_BCL2A1-      QKEVEKNLKPCLDNV-------NVASIDTARTLFNQV-----------ME
A0A2K6PPI3_MCL1-02      RPP---PIGAEVPDVTGTPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQV-----------SD
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQV-----------SD
A0A2K6RW35_BCL2L2-      GDEFETRFRRTFSDL----AAQLHVTPGSAQQRFTQV-----------SD
A0A2K6QFA2_BCL2L1-      ---LNRRWRPPVPSM----ATH----PGTAYQSFEQV-----------VN
A0A2K6QFA2_BCL2L1-      GDEFELRYRRAFSDL----TSQLHITPGTAYQSFEQV-----------VN
A0A2K6QFA2_BCL2L1-      GDEFELRYRRAFSDL----TSQLHITPGTAYQSFEQV-----------VN
A0A2K6PPI3_MCL1-03      GDGVQRNHETAFQGM----LRKLDIKNEDDVKSLSRV-----------MV
A0A2K6R5T5_BCL2L10      AARLRQLHRSFFSAYLGYPGNRVELVALMAEAVLSD--------------
A0A2K6R2I5_BCL2-01      GDDFSRRYRRDFAEM----SSQLHLTPFTARGRFATV-----------VE
A0A2K6R2I5_BCL2-02      GDDFSRRYRRDFAEM----SSQLHLTPFTARGRFATV-----------VE
                                   .                     :                

A0A2K6PHF2_BCL2A1-      KEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQQI
A0A2K6PHF2_BCL2A1-      KEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQQI
A0A2K6PPI3_MCL1-02      ELDGYEPEPLGKRPAVLPLLELVGESGNSSSTDGSLPST---PPPAEEEE
A0A2K6RW35_BCL2L2-      ELFQGGP-NWGRLVAFFVFGAALC------------------AESVNKEM
A0A2K6RW35_BCL2L2-      ELFQGGP-NWGRLVAFFVFGAALC------------------AESVNKEM
A0A2K6RW35_BCL2L2-      ELFQGGP-NWGRLVAFFVFGAALC------------------AESVNKEM
A0A2K6QFA2_BCL2L1-      ELFRDGV-NWGRIVAFFSFGGALC------------------VESVDKEM
A0A2K6QFA2_BCL2L1-      ELFRDGV-NWGRIVAFFSFGGALC------------------VESVDKEM
A0A2K6QFA2_BCL2L1-      ELFRDGV-NWGRIVAFFSFGGALC------------------VESVDKEM
A0A2K6PPI3_MCL1-03      HVFSDGVTNWGRIVTLISFGAFVAKH----------------LKTINQES
A0A2K6R5T5_BCL2L10      ---SPGP-TWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGEV
A0A2K6R2I5_BCL2-01      ELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNREM
A0A2K6R2I5_BCL2-02      ELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNREM
                                  *.  :.. :   :                         : 

A0A2K6PHF2_BCL2A1-      APDVDTYKEISYFVAEFIMNNT-----GEWIRQNGGWGK-----------
A0A2K6PHF2_BCL2A1-      APDVDTYKEISYFVAEFIMNNT-----GEWIRQNGGWENGFVKKFEPKSG
A0A2K6PPI3_MCL1-02      DELYR---QSLEIISRYLREQATGAKDTKPMGRSGATSR-----------
A0A2K6RW35_BCL2L2-      EPLVG---QVQEWMVAYLETRL-----ADWIHSSGGWEL-----------
A0A2K6RW35_BCL2L2-      EPLVG---QVQEWMVAYLETRL-----ADWIHSSGGWA------------
A0A2K6RW35_BCL2L2-      EPLVG---QVQEWMVAYLETRL-----ADWIHSSGGWA------------
A0A2K6QFA2_BCL2L1-      QVLVS---RIAAWMATYLNDHL-----EPWIQENGGWD------------
A0A2K6QFA2_BCL2L1-      QVLVS---RIAAWMATYLNDHL-----EPWIQENGGWD------------
A0A2K6QFA2_BCL2L1-      QVLVS---RIAAWMATYLNDHL-----EPWIQENGGWD------------
A0A2K6PPI3_MCL1-03      C--IE---PLAESITDVLVRTK-----RDWLVKQRGWD------------
A0A2K6R5T5_BCL2L10      ARDCQ---RLVALLSSRLTGQH-----RAWLQAQGGWV------------
A0A2K6R2I5_BCL2-01      SPLVD---NIALWMTEYLNRHL-----HTWIQDNGGWD------------
A0A2K6R2I5_BCL2-02      SPLVD---NIALWMTEYLNRHL-----HTWIQDNGGWR------------
                                     :   :            :  . .              

A0A2K6PHF2_BCL2A1-      WHNHMPM---LVESVAHKKKKMAL--------------------------
A0A2K6PHF2_BCL2A1-      WMTFLEVTGKICEMLSLLKQYC----------------------------
A0A2K6PPI3_MCL1-02      --KALETLRRVGDGVQRNHETAFQGWVCGVLPCRGPRRWHQKCAAGFCRC
A0A2K6RW35_BCL2L2-      --EAIKARVREMEEEAEKLKELQNEVE-------KQMNMSPPPGNAGPVI
A0A2K6RW35_BCL2L2-      --EFTALYGDGALEEARRLRE----------------------GNWASV-
A0A2K6RW35_BCL2L2-      --EFTALYGDGALEEARRLRE----------------------GNWASV-
A0A2K6QFA2_BCL2L1-      --TFVELYGNNAAAESRKGQERFNRWF-----------------------
A0A2K6QFA2_BCL2L1-      --TFVELYGNNAAAESRKGQERFNRWF-----------------------
A0A2K6QFA2_BCL2L1-      --TFVELYGNNAAAESRKGQERFNRWF-----------------------
A0A2K6PPI3_MCL1-03      --GFVEFFHVE---------------------------------------
A0A2K6R5T5_BCL2L10      --STRRTPGRGAGRASGKRPRGRHGWLLSLLQDPLSAGFLEKTADPGFPG
A0A2K6R2I5_BCL2-01      --AFVELYG------PSMRPLFDFSWL-----------------------
A0A2K6R2I5_BCL2-02      --TMC-------------------TWC-----------------------
                                                                          

A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PPI3_MCL1-02      CWSRSWFGISNKIALL----------------------------------
A0A2K6RW35_BCL2L2-      MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
A0A2K6RW35_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A2K6RW35_BCL2L2-      -----------RTVLTGAVALGALVTV-----------------------
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLL------------------------
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLL------------------------
A0A2K6QFA2_BCL2L1-      --------------LTGMTVAGVVLL------------------------
A0A2K6PPI3_MCL1-03      -----DLEGGIRNVLLAFAGVAGVGA------------------------
A0A2K6R5T5_BCL2L10      MLVNNSLRLPLDTIIMSFKIFNPLLP------------------------
A0A2K6R2I5_BCL2-01      -----SLKTLLSLALVGACITLGAYL------------------------
A0A2K6R2I5_BCL2-02      -----RFR------------------------------------------
                                                                          

A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PHF2_BCL2A1-      --------------------------------------------------
A0A2K6PPI3_MCL1-02      --------------------------------------------------
A0A2K6RW35_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6RW35_BCL2L2-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6QFA2_BCL2L1-      --------------------------------------------------
A0A2K6PPI3_MCL1-03      --------------------------------------------------
A0A2K6R5T5_BCL2L10      --------------------------------------------------
A0A2K6R2I5_BCL2-01      --------------------------------------------------
A0A2K6R2I5_BCL2-02      --------------------------------------------------
                                                                          

A0A2K6PHF2_BCL2A1-      ------------------------------------
A0A2K6PHF2_BCL2A1-      ------------------------------------
A0A2K6PPI3_MCL1-02      ------------------------------------
A0A2K6RW35_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
A0A2K6RW35_BCL2L2-      -----------------------------GAFFASK
A0A2K6RW35_BCL2L2-      -----------------------------GAFFASK
A0A2K6QFA2_BCL2L1-      -----------------------------GSLFSRK
A0A2K6QFA2_BCL2L1-      -----------------------------GSLFSRK
A0A2K6QFA2_BCL2L1-      -----------------------------GSLFSRK
A0A2K6PPI3_MCL1-03      -----------------------------GLAYLIR
A0A2K6R5T5_BCL2L10      -----------------------------AQL----
A0A2K6R2I5_BCL2-01      -----------------------------GHK----
A0A2K6R2I5_BCL2-02      -----------------------------GCD----
                                                            

© 1998-2019