Dataset for protein Bcl-2 of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6R2I6_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
A0A2K6R2I6_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFS
                        **************************************************

A0A2K6R2I6_BCL2-01      SQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQA
A0A2K6R2I6_BCL2-02      SQPGHTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQA
                        **************************************************

A0A2K6R2I6_BCL2-01      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
A0A2K6R2I6_BCL2-02      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
                        **************************************************

A0A2K6R2I6_BCL2-01      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
A0A2K6R2I6_BCL2-02      FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWRTMC-
                        ********************************************* ::  

A0A2K6R2I6_BCL2-01      LYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
A0A2K6R2I6_BCL2-02      ------------TWCRFR------------------GCD
                                    :*  :.                  * .

© 1998-2019