Dataset for protein Mcl-1 of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KRW9_MCL1-01      MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K6KRW9_MCL1-02      MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
                        **************************************************

A0A2K6KRW9_MCL1-01      GEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFA
A0A2K6KRW9_MCL1-02      GEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFFA
                        **************************************************

A0A2K6KRW9_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K6KRW9_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
                        **************************************************

A0A2K6KRW9_MCL1-01      GNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K6KRW9_MCL1-02      GNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
                        **************************************************

A0A2K6KRW9_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2K6KRW9_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
                        ****************************** :  :               

A0A2K6KRW9_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2K6KRW9_MCL1-02      --LPCRGPRRW---------------------HQKCAAGFCRCCWS----
                          : . *  .*                     ::.*   :. .  .    

A0A2K6KRW9_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K6KRW9_MCL1-02      --RSWF---------------------------------GISNKIALL--
                          *.*:                                 *:.  :* *  

© 1998-2019