Dataset for protein BCL-2-like of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6LV22_BCL2A1-      ----------MTDCEFGYIYRLAQDYLQYVL-------------------
A0A2K6LV22_BCL2A1-      ----------MTDCEFGYIYRLAQDYLQYVL-------------------
A0A2K6KHG1_BCL2-01      --------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGA
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTE
A0A2K6KRW9_MCL1-01      -MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIG
A0A2K6KRW9_MCL1-02      -MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIG
A0A2K6MEE6_BCL2L2-      MATPASAPDTRA---------LVADFVGYKLRQKGYV-------------
A0A2K6MEE6_BCL2L2-      MATPASAPDTRA---------LVADFVGYKLRQKGYV-------------
A0A2K6KRW9_MCL1-03      -MFGFKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL-------------
A0A2K6M5H5_BCL2L10      MADPLRERTTVADPLRERTERLLADYLGCCAR------------------
                                                                          

A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      APAPGIFSSQPGHTPHPAASRDPVARTSPLPTP-----------------
A0A2K6LPM4_BCL2L1-      ----------------------MWKRTGLRPQK-----------------
A0A2K6LPM4_BCL2L1-      APEG---TESEMETPSAINGNPSWHLVDSPAVN-----------------
A0A2K6KRW9_MCL1-01      GGEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFF
A0A2K6KRW9_MCL1-02      GGEAGTVIGESAGASPPAALTPDARRVARPPPIGAEVPDVTGTPARLLFF
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6KRW9_MCL1-01      APTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGE
A0A2K6KRW9_MCL1-02      APTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGE
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV22_BCL2A1-      ----------------------------------------QIPQPGSGPS
A0A2K6LV22_BCL2A1-      ----------------------------------------QIPQPGSGPS
A0A2K6KHG1_BCL2-01      ----------------------------------------AAPAAAAGPA
A0A2K6LPM4_BCL2L1-      ----------------------------------------G---------
A0A2K6LPM4_BCL2L1-      ----------------------------------------GATGHSSSLD
A0A2K6KRW9_MCL1-01      SGNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPM
A0A2K6KRW9_MCL1-02      SGNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPM
A0A2K6MEE6_BCL2L2-      ----------------------------------------CGAGPGEGPA
A0A2K6MEE6_BCL2L2-      ----------------------------------------CGAGPGEGPA
A0A2K6KRW9_MCL1-03      ----------------------------------------ATGAKDTKPM
A0A2K6M5H5_BCL2L10      ----------------------------------------EPGTPEPRPS
                                                                          

A0A2K6LV22_BCL2A1-      --------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQ
A0A2K6LV22_BCL2A1-      --------KTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQ
A0A2K6KHG1_BCL2-01      LSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFAT
A0A2K6LPM4_BCL2L1-      --------------------LNRRWRPPVPSMATH----P-GTAYQSFEQ
A0A2K6LPM4_BCL2L1-      AREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQ
A0A2K6KRW9_MCL1-01      GRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSR
A0A2K6KRW9_MCL1-02      GRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV--------------
A0A2K6MEE6_BCL2L2-      AD------PLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQ
A0A2K6MEE6_BCL2L2-      AD------PLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQ
A0A2K6KRW9_MCL1-03      GRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSR
A0A2K6M5H5_BCL2L10      TPEAAVLRSAAARLRQ----LHRSFFSAYLGY-------P-GNRVELVAL
                                            .                             

A0A2K6LV22_BCL2A1-      VMEKEFEDGI-INWGRIVTIFAFEGILIKKL-------LRQQIAPDVDTY
A0A2K6LV22_BCL2A1-      VMEKEFEDGI-INWGRIVTIFAFEGILIKKL-------LRQQIAPDVDTY
A0A2K6KHG1_BCL2-01      VVEELFRDG--VNWGRIVAFFEFGGVMCVES-------VNREMSPLVDN-
A0A2K6LPM4_BCL2L1-      VVNELFRDG--VNWGRIVAFFSFGGALCVES-------VDKEMQVLVSR-
A0A2K6LPM4_BCL2L1-      VVNELFRDG--VNWGRIVAFFSFGGALCVES-------VDKEMQVLVSR-
A0A2K6KRW9_MCL1-01      VMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCIEP-----
A0A2K6KRW9_MCL1-02      ----LPCRGP-RRW------------------------HQKCAAG-----
A0A2K6MEE6_BCL2L2-      VSDELFQGG--PNWGRLVAFFVFGAALCAES-------VNKEMEPLVGQ-
A0A2K6MEE6_BCL2L2-      VSDELFQGG--PNWGRLVAFFVFGAALCAES-------VNKEMEPLVGQ-
A0A2K6KRW9_MCL1-03      VMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTIN---QESCIEP-----
A0A2K6M5H5_BCL2L10      MAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQ
                                .    *                                    

A0A2K6LV22_BCL2A1-      KE--------ISYFVAEFIMNNTGEWIRQNGGWE----------------
A0A2K6LV22_BCL2A1-      KE--------ISYFVAEFIMNNTGEWIRQNGGWG----------------
A0A2K6KHG1_BCL2-01      ----------IALWMTEYLNRHLHTWIQDNGGWD----------------
A0A2K6LPM4_BCL2L1-      ----------IAAWMATYLNDHLEPWIQENGGWD----------------
A0A2K6LPM4_BCL2L1-      ----------IAAWMATYLNDHLEPWIQENGGWD----------------
A0A2K6KRW9_MCL1-01      ----------LAESITDVLVRTKRDWLVKQRGWD----------------
A0A2K6KRW9_MCL1-02      ----------FCRCCWS------RSWF-----------------------
A0A2K6MEE6_BCL2L2-      ----------VQEWMVAYLETRLADWIHSSGGWA-EFTALYGDGALEEAR
A0A2K6MEE6_BCL2L2-      ----------VQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAE
A0A2K6KRW9_MCL1-03      ----------LAESITDVLVRTKRDWLVKQRGWD----------------
A0A2K6M5H5_BCL2L10      EGDVARDCQRLVALLSSRLTGQHRAWLQAQGGWD----------------
                                  .              *:                       

A0A2K6LV22_BCL2A1-      ---------------------NGFVKKFEPKS------------------
A0A2K6LV22_BCL2A1-      ---------------------K----------------------------
A0A2K6KHG1_BCL2-01      ----------------------AFVELYGPSM-------RPLFDFSWLSL
A0A2K6LPM4_BCL2L1-      ----------------------TFVELYGNNAAAESRKGQERFN------
A0A2K6LPM4_BCL2L1-      ----------------------TFVELYGNNAAAESRKGQERFN------
A0A2K6KRW9_MCL1-01      ----------------------GFVEFFHVEDLEGGIR------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      RLRE---------------GNWASV------------R------------
A0A2K6MEE6_BCL2L2-      KLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR------------
A0A2K6KRW9_MCL1-03      ----------------------GFVEFFHVEDLEGGIR------------
A0A2K6M5H5_BCL2L10      ----------------------GFCHFFRTPFPLAFWR------------
                                                                          

A0A2K6LV22_BCL2A1-      GWMTFLEVTGKICEMLSLLKQYC---------------------------
A0A2K6LV22_BCL2A1-      -WHNHMPM---LVESVAHRKKKMAL-------------------------
A0A2K6KHG1_BCL2-01      KTLLSLALVGACITLGAYLGHK----------------------------
A0A2K6LPM4_BCL2L1-      RWFLTGMTVAGVVLLGSLFSRK----------------------------
A0A2K6LPM4_BCL2L1-      RWFLTGMTVAGVVLLGSLFSRK----------------------------
A0A2K6KRW9_MCL1-01      NVLLAFAGVAGVGAGLAYLIR-----------------------------
A0A2K6KRW9_MCL1-02      ----------GISNKIALL-------------------------------
A0A2K6MEE6_BCL2L2-      TVLTGAVALGALVTV-----------------------------------
A0A2K6MEE6_BCL2L2-      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A2K6KRW9_MCL1-03      NVLLAFAGVAGVGAGLAYLIR-----------------------------
A0A2K6M5H5_BCL2L10      KLLIQAFLACLLTTAFGYLWTRLL--------------------------
                                                                          

A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6LV22_BCL2A1-      --------------------------------------------------
A0A2K6KHG1_BCL2-01      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6LPM4_BCL2L1-      --------------------------------------------------
A0A2K6KRW9_MCL1-01      --------------------------------------------------
A0A2K6KRW9_MCL1-02      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      --------------------------------------------------
A0A2K6MEE6_BCL2L2-      KESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTN
A0A2K6KRW9_MCL1-03      --------------------------------------------------
A0A2K6M5H5_BCL2L10      --------------------------------------------------
                                                                          

A0A2K6LV22_BCL2A1-      ------------------------
A0A2K6LV22_BCL2A1-      ------------------------
A0A2K6KHG1_BCL2-01      ------------------------
A0A2K6LPM4_BCL2L1-      ------------------------
A0A2K6LPM4_BCL2L1-      ------------------------
A0A2K6KRW9_MCL1-01      ------------------------
A0A2K6KRW9_MCL1-02      ------------------------
A0A2K6MEE6_BCL2L2-      -----------------GAFFASK
A0A2K6MEE6_BCL2L2-      YNSSRSRFYSGFNSRPRGRVYRSG
A0A2K6KRW9_MCL1-03      ------------------------
A0A2K6M5H5_BCL2L10      ------------------------
                                                

© 1998-2019