Dataset for protein BCL-2-like of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3V977_BCL2A1-01       --------------------------------------------------
Q925A9_BCL2A1-01       --------------------------------------------------
Q99M66_BCL2L10-01      --------------------------------------------------
Q9Z1P3_MCL1-01         MFGLRRNAVIGLNLYCGGASLGAGGGSPAGTRLAAEEAKARREGGGEAAL
O88996_BCL2L2-01       --------------------------------------------------
Q7TS60_BCL2L2-01       -------------------------------MSLFGLCQYFSYIYVSLSS
Q7TSN8_BCL2-01         --------------------------------------------------
F1LNV0_BCL2-01         --------------------------------------------------
P49950_BCL2-01         --------------------------------------------------
P53563_BCL2L1-02       --------------------------------------------------
P53563_BCL2L1-03       --------------------------------------------------
P53563_BCL2L1-04       --------------------------------------------------
P53563_BCL2L1-01       --------------------------------------------------
                                                                         

G3V977_BCL2A1-01       --------MTDCEFMYIHSLAENYLQYVLQVPAF-ESAPSKTS-------
Q925A9_BCL2A1-01       --------MTDCEFMYIHSLAENYLQYVLQVPAF-ESAPSKTS-------
Q99M66_BCL2L10-01      --------MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVE-------
Q9Z1P3_MCL1-01         LPGARVVARPPPVGAEDPDVTASAERRLLKSPGLLAVPPEEMAASAAAIM
O88996_BCL2L2-01       -------MATPASTPDTRALVADFVGYKLRQKGY----------------
Q7TS60_BCL2L2-01       LPLSAARMATPASTPDTRALVADFVGYKLRQKGY----------------
Q7TSN8_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGA--
F1LNV0_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRA--
P49950_BCL2-01         ------MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRA--
P53563_BCL2L1-02       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--
P53563_BCL2L1-03       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--
P53563_BCL2L1-04       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--
P53563_BCL2L1-01       ------MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTE--
                                          :  .                           

G3V977_BCL2A1-01       --------------------------------------------------
Q925A9_BCL2A1-01       --------------------------------------------------
Q99M66_BCL2L10-01      --------------------------------------------------
Q9Z1P3_MCL1-01         SPEEELDGCEPEVLSKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEE
O88996_BCL2L2-01       ---------------------------------VCGAGPGEGPAA-----
Q7TS60_BCL2L2-01       ---------------------------------VCGAGPGEGPAA-----
Q7TSN8_BCL2-01         APTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVP-----
F1LNV0_BCL2-01         APTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVATAGPALSPVP-----
P49950_BCL2-01         APTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVP-----
P53563_BCL2L1-02       APEET----EPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP
P53563_BCL2L1-03       APEET----EPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP
P53563_BCL2L1-04       APEET----EPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP
P53563_BCL2L1-01       APEET----EPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIP
                                                                         

G3V977_BCL2A1-01       ----------------------------------------RVLQRVAFSV
Q925A9_BCL2A1-01       ----------------------------------------RVLQRVAFSV
Q99M66_BCL2L10-01      ----------------------------------------AALLRSVTSQ
Q9Z1P3_MCL1-01         DDELYHQSLEIISRYLREQATGSKDAKPLGEAGAAGRRALETLRRVGDGV
O88996_BCL2L2-01       -DPLH-----------------------------------QAMRAAGDEF
Q7TS60_BCL2L2-01       -DPLH-----------------------------------QAMRAAGDEF
Q7TSN8_BCL2-01         -PVVH-----------------------------------LTLRRAGDDF
F1LNV0_BCL2-01         -PVVH-----------------------------------LTLRRAGDDF
P49950_BCL2-01         -PVVH-----------------------------------LTLRRAGDDF
P53563_BCL2L1-02       MAAVK-----------------------------------QALREAGDEF
P53563_BCL2L1-03       MAAVK-----------------------------------QALREAGDEF
P53563_BCL2L1-04       MAAVK-----------------------------------QALREAGDEF
P53563_BCL2L1-01       MAAVK-----------------------------------QALREAGDEF
                                                                .:       

G3V977_BCL2A1-01       QKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFA
Q925A9_BCL2A1-01       QKEVEKNLKPYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFA
Q99M66_BCL2L10-01      IQQEHQDLFNSFRDYQGNRLELVTQMADELLSNDQE---FNWGRLVMLLA
Q9Z1P3_MCL1-01         QRNHETAFQGMLRKLDIKN-EDDVKSFSRVMTHVFKDGVTNWGRIVTLIS
O88996_BCL2L2-01       ETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGP-NWGRLVAFFV
Q7TS60_BCL2L2-01       ETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGGP-NWGRLVAFFV
Q7TSN8_BCL2-01         SRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGV-NWGRIVAFFE
F1LNV0_BCL2-01         SRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGV-NWGRIVAFFE
P49950_BCL2-01         SRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGV-NWGRIVAFFE
P53563_BCL2L1-02       ELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFS
P53563_BCL2L1-03       ELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFS
P53563_BCL2L1-04       ELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFS
P53563_BCL2L1-01       ELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV-NWGRIVAFFS
                              :     .               :          ****:* :: 

G3V977_BCL2A1-01       FGGVLL--------KKLPQEQIALDVDTYKQVSSFVAEFIMNNTGEWIQQ
Q925A9_BCL2A1-01       FGGVLL--------KKLPQEQIGLDVDTYKQVSSFVAEFIMNNTGEWIQQ
Q99M66_BCL2L10-01      FVGTLMNQDRTVKRRRDQRNRLLLERDCY-LIVSLLYNRLTGRHRSWLEA
Q9Z1P3_MCL1-01         FGAFVA--------KHLKSINQESCIE---PLAESITDVLVRTKRDWLVK
O88996_BCL2L2-01       FGAALC--------AESVNKEMEPLVG---QVQDWMVTYLETRLADWIHS
Q7TS60_BCL2L2-01       FGAALC--------AESVNKEMEPLVG---QVQDWMVTYLETRLADWIHS
Q7TSN8_BCL2-01         FGGVMC--------VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
F1LNV0_BCL2-01         FGGVMC--------VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
P49950_BCL2-01         FGGVMC--------VGSVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
P53563_BCL2L1-02       FGGALC--------VESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
P53563_BCL2L1-03       FGGALC--------VESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
P53563_BCL2L1-04       FGGALC--------VESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
P53563_BCL2L1-01       FGGALC--------VESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
                       * . :                          :   :   :      *:  

G3V977_BCL2A1-01       NGGWEDGFTKKFE---P----------------------KSGWLTFLQMT
Q925A9_BCL2A1-01       NGGWEDGFTKKFE---P----------------------KSGWLTFLQMT
Q99M66_BCL2L10-01      HGGW-DGFCQFFKNPLP----------------------PGFWRRLL--I
Q9Z1P3_MCL1-01         QRGW-DGFVEFFH---VQDLEGGIRN-------------VLLAFAGVAGV
O88996_BCL2L2-01       SGGW-AEFTALYG---DGALEEARRLREGNWASVRTVLTGAVALGALVTV
Q7TS60_BCL2L2-01       SGGW-AEFTALYG---DGALEEARRLREGNWASVRTVLTGAVALGALVTV
Q7TSN8_BCL2-01         NGGW-DAFVELYG---P----SMRPLFDFSWLSLKTLL-SLALVGACITL
F1LNV0_BCL2-01         NGGW-DAFVELYG---P----SMRPLFDFSWLSLKTLL-SLALVGACITL
P49950_BCL2-01         NGGW-DAFVELYG---P----SMRPLFDFSWLSLKTLL-SLALVGACITL
P53563_BCL2L1-02       NGGW-VRTTPLVC---P----PLVCLSSVEIPNCPFWS-PGMVVEDIDYS
P53563_BCL2L1-03       NGGW-VRTTPLVC---P----PLVCLSSVEIPNCPFWS-PGMVVEDIDYS
P53563_BCL2L1-04       NGGW-VRTTPLVC---P----PLVCLSSVEIPNCPFWS-PGMVVEDIDYS
P53563_BCL2L1-01       NGGW-DTFVDLYG---N----NAAAESRKGQERFNRWFLTGMTVAGVVLL
                         **                                              

G3V977_BCL2A1-01       GKIWEMLFLLKQHY------------------------------------
Q925A9_BCL2A1-01       GKIWEMLFLLKQHY------------------------------------
Q99M66_BCL2L10-01      RAILSCFFATAIFYIWKCL-------------------------------
Q9Z1P3_MCL1-01         GAGLAYLIR-----------------------------------------
O88996_BCL2L2-01       GAFFASK-------------------------------------------
Q7TS60_BCL2L2-01       GAFFASK-------------------------------------------
Q7TSN8_BCL2-01         GAYLGHK-------------------------------------------
F1LNV0_BCL2-01         GAYLGHK-------------------------------------------
P49950_BCL2-01         GAYLGHK-------------------------------------------
P53563_BCL2L1-02       GDIPGFTLIPGVNFGNIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKT
P53563_BCL2L1-03       GDIPGFTLIPGVNFGNIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKT
P53563_BCL2L1-04       GDIPGSL-------------------------------------------
P53563_BCL2L1-01       GSLFSRK-------------------------------------------
                                                                         

G3V977_BCL2A1-01       ---------
Q925A9_BCL2A1-01       ---------
Q99M66_BCL2L10-01      ---------
Q9Z1P3_MCL1-01         ---------
O88996_BCL2L2-01       ---------
Q7TS60_BCL2L2-01       ---------
Q7TSN8_BCL2-01         ---------
F1LNV0_BCL2-01         ---------
P49950_BCL2-01         ---------
P53563_BCL2L1-02       ACVFTWLKT
P53563_BCL2L1-03       ACVFTWLKT
P53563_BCL2L1-04       ---------
P53563_BCL2L1-01       ---------
                                

© 1998-2019