Dataset for protein Bcl-w of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O88996_BCL2L2-01      --------------------------MATPASTPDTRALVADFVGYKLRQ
Q7TS60_BCL2L2-01      MSLFGLCQYFSYIYVSLSSLPLSAARMATPASTPDTRALVADFVGYKLRQ
                                                ************************

O88996_BCL2L2-01      KGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
Q7TS60_BCL2L2-01      KGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGS
                      **************************************************

O88996_BCL2L2-01      AQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQD
Q7TS60_BCL2L2-01      AQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQD
                      **************************************************

O88996_BCL2L2-01      WMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVL
Q7TS60_BCL2L2-01      WMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVL
                      **************************************************

O88996_BCL2L2-01      TGAVALGALVTVGAFFASK
Q7TS60_BCL2L2-01      TGAVALGALVTVGAFFASK
                      *******************

© 1998-2019