Dataset for protein Bcl-xL of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P53563_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSA
P53563_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSA
P53563_BCL2L1-04      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSA
P53563_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSA
                      **************************************************

P53563_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
P53563_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
P53563_BCL2L1-04      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
P53563_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

P53563_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
P53563_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
P53563_BCL2L1-04      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
P53563_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

P53563_BCL2L1-02      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLV
P53563_BCL2L1-03      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLV
P53563_BCL2L1-04      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLV
P53563_BCL2L1-01      CVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAA
                      **************************************   . *     .

P53563_BCL2L1-02      CLSSVEIPNCPFWS-PGMVVEDIDYSGDIPGFTLIPGVNFGNIDDPVFKE
P53563_BCL2L1-03      CLSSVEIPNCPFWS-PGMVVEDIDYSGDIPGFTLIPGVNFGNIDDPVFKE
P53563_BCL2L1-04      CLSSVEIPNCPFWS-PGMVVEDIDYSGDIPGSL-----------------
P53563_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------------
                      . *     .   *  .**.* .:   *.: .                   

P53563_BCL2L1-02      PVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
P53563_BCL2L1-03      PVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT
P53563_BCL2L1-04      -----------------------------------
P53563_BCL2L1-01      -----------------------------------
                                                         

© 1998-2019