Dataset for protein Bcl-2 of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q7TSN8_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
F1LNV0_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
P49950_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPA
                    *******************************:** *:*** ***************  **

Q7TSN8_BCL2-01      VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
F1LNV0_BCL2-01      VHRDTAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
P49950_BCL2-01      VHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
                    **** ************.******************************************

Q7TSN8_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
F1LNV0_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
P49950_BCL2-01      FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVGSVNREMSPLVDNIALWMTEYLNR
                    ************************************ ***********************

Q7TSN8_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
F1LNV0_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
P49950_BCL2-01      HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                    ********************************************************

© 1998-2019