Dataset for protein Mcl-1 of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4C6H5_MCL1-01      --------------------------------------LFSFVWEFSRKW
A0A3B4C6H5_MCL1-02      ---------MVRLFGVGLRVVHYAKYPKTVFPSLLAKRPFTLGISSQTRA
A0A3B4C6H5_MCL1-03      -------------MMMSPKEMYFDK--KTVFPSLLAKRPFTLGISSQTRA
A0A3B4E3I4_MCL1-03      MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEG-------LQAAP
A0A3B4E3I4_MCL1-02      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
A0A3B4E3I4_MCL1-01      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
                                                                          

A0A3B4C6H5_MCL1-01      PWNFLWEKLIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4C6H5_MCL1-02      P-------RIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4C6H5_MCL1-03      P-------RIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4E3I4_MCL1-03      G-----PASKAAMAGGSLPESPESDDFVPDF-------------------
A0A3B4E3I4_MCL1-02      G-----GSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEV
A0A3B4E3I4_MCL1-01      G-----GSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEV
                                  ::   ** * :*       :                    

A0A3B4C6H5_MCL1-01      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4C6H5_MCL1-02      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4C6H5_MCL1-03      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4E3I4_MCL1-03      ---------GGSALVEETRRLIGGFYRGYIG--QKTRDQHPAHGTMSRVV
A0A3B4E3I4_MCL1-02      TVLIKPKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVV
A0A3B4E3I4_MCL1-01      TVLIKPKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVV
                                     *  :*  :: .* ..:         :. .  *: ***

A0A3B4C6H5_MCL1-01      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4C6H5_MCL1-02      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4C6H5_MCL1-03      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4E3I4_MCL1-03      EGVILKHSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIAS
A0A3B4E3I4_MCL1-02      EGMLHKHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFDDGITNWGRIAS
A0A3B4E3I4_MCL1-01      EGMLHKHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIAS
                        :*:: **.:.*.**. ** :*:..*.* :* :*** **.** ********

A0A3B4C6H5_MCL1-01      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4C6H5_MCL1-02      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4C6H5_MCL1-03      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4E3I4_MCL1-03      LVAFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFV
A0A3B4E3I4_MCL1-02      LVALGAVVCEWLKEVGREQCVENVIQHISMYLSTDQRQWLINNKAWGGFV
A0A3B4E3I4_MCL1-01      LVAFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFV
                        *:*:*****:. :: ** :**. * * ** ** :**.:**::****.***

A0A3B4C6H5_MCL1-01      EFFHVPDPESKMRNALMALVTAAGVGAGLVLLSR
A0A3B4C6H5_MCL1-02      EFFHVPDPESKMRNALMALVTAAGVGAGLVLLSR
A0A3B4C6H5_MCL1-03      EFFHVPDPESKMRNALMALVTAAGVGAGLVLLSR
A0A3B4E3I4_MCL1-03      EFFREDDSESRVRNALMAFAGFAGLGAGLALLMR
A0A3B4E3I4_MCL1-02      EFFREDDSESRVRNALMAFAGFAGLGAGLALLMR
A0A3B4E3I4_MCL1-01      EFFREDDSESRVRNALMAFAGFAGLGAGLALLMR
                        ***.  *.**.:******:.  **:****.** *

© 1998-2019