Dataset for protein BCL-2-like of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4DTL9_BCL2L1-      ----------------------------MSYYNRELVVYFIKYKLSQRNY
A0A3B4C6H5_MCL1-01      --------------------------------------LFSFVWEFSRKW
A0A3B4C6H5_MCL1-02      ---------MVRLFGVGLRVVHYAKYPKTVFPSLLAKRPFTLGISSQTRA
A0A3B4C6H5_MCL1-03      -------------MMMSPKEMYFDK--KTVFPSLLAKRPFTLGISSQTRA
A0A3B4E3I4_MCL1-03      MESAAISLFCNGAGRIPFNKGSESQLDRPDRPDRGLEG-------LQAAP
A0A3B4E3I4_MCL1-02      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
A0A3B4E3I4_MCL1-01      ME-------AHGGVQINMAAHPGGSICAPVLHGSSFGGPVTLIYLIHGGQ
                                                                          

A0A3B4DTL9_BCL2L1-      PYNHIGLMEDTNRTEGGQAAEENAEGAAVTPTAVVNGSVNGTSHGPAGSP
A0A3B4C6H5_MCL1-01      PWNFLWEKLIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4C6H5_MCL1-02      P-------RIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4C6H5_MCL1-03      P-------RIAAVTDGSLPTSPASDCEELDS-------------------
A0A3B4E3I4_MCL1-03      G-----PASKAAMAGGSLPESPESDDFVPDF-------------------
A0A3B4E3I4_MCL1-02      G-----GSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEV
A0A3B4E3I4_MCL1-01      G-----GSSSSSAQTGS-PAAPELTHVQVNSISISSTKEQTTISLCDGEV
                                  :    *. .                               

A0A3B4DTL9_BCL2L1-      TSSPQRRSNGAGGLD-------------------------AVKEALRDSA
A0A3B4C6H5_MCL1-01      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4C6H5_MCL1-02      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4C6H5_MCL1-03      -----DQFKESETLDRDTSEIVIDFLQNFTGLSRSCGRHRGVVQTIRRVV
A0A3B4E3I4_MCL1-03      ---------GGSALVEETRRLIGGFYRGYIG--QKTRDQHPAHGTMSRVV
A0A3B4E3I4_MCL1-02      TVLIKPKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVV
A0A3B4E3I4_MCL1-01      TVLIKPKPKGRVRLEEETLCIIGDFYQGY-----RSRNQHPASDTLSRVV
                                     *                           .  ::   .

A0A3B4DTL9_BCL2L1-      NEFELRYSRAFSDLSSQLHITP-ATAYQSFESVMDEVFRDGV-NWGRVVG
A0A3B4C6H5_MCL1-01      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4C6H5_MCL1-02      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4C6H5_MCL1-03      DGLVVKHELVYKGMFTRLGMEDRGDDMHIIRTVAKELFSDGITNWGRIAS
A0A3B4E3I4_MCL1-03      EGVILKHSIAYNGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIAS
A0A3B4E3I4_MCL1-02      EGMLHKHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFDDGITNWGRIAS
A0A3B4E3I4_MCL1-01      EGMLHKHSVAYSGMVQRLCLEQQDDSMEFISSVAKTLFNDGTTNWGRIAS
                        : .  .:. .:..:  .* :         : :* . :* **  ****:..

A0A3B4DTL9_BCL2L1-      LFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGWERFA
A0A3B4C6H5_MCL1-01      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4C6H5_MCL1-02      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4C6H5_MCL1-03      LLAFGAVVCQHQNQMGRGHCVSLVGQEISSYLLSDQKDWLLKNKAWDGFV
A0A3B4E3I4_MCL1-03      LVAFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFV
A0A3B4E3I4_MCL1-02      LVALGAVVCEWLKEVGREQCVENVIQHISMYLSTDQRQWLINNKAWGGFV
A0A3B4E3I4_MCL1-01      LVAFGAVVCEQMKEAGREQCVENVIQHISTYLSTDQRQWLINNKAWGGFV
                        *.*:*..:*    :      *  : : :: ** .  . *: :: .*  *.

A0A3B4DTL9_BCL2L1-      EIFGKDAAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3B4C6H5_MCL1-01      EFFHVPDPESKMRNA-------LMALVTAAGVGAGLVLLSR--
A0A3B4C6H5_MCL1-02      EFFHVPDPESKMRNA-------LMALVTAAGVGAGLVLLSR--
A0A3B4C6H5_MCL1-03      EFFHVPDPESKMRNA-------LMALVTAAGVGAGLVLLSR--
A0A3B4E3I4_MCL1-03      EFFREDDSESRVRNA-------LMAFAGFAGLGAGLALLMR--
A0A3B4E3I4_MCL1-02      EFFREDDSESRVRNA-------LMAFAGFAGLGAGLALLMR--
A0A3B4E3I4_MCL1-01      EFFREDDSESRVRNA-------LMAFAGFAGLGAGLALLMR--
                        *:*    . .  *.        * .:.  :*: .*  :  .  

© 1998-2019