Dataset for protein BCL-2-like of organism Pundamilia nyererei

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4G4Z6_MCL1-01      ---------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSPQNA
A0A3B4ETX9_BCL2L10      MCREQSDIAGRKMKFCGLWKETLVLA--------------------EDYL
A0A3B4FNX1_BCL2L1-      --MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGAAGLDEEQRI
A0A3B4G3K4_BCL2-01      MANEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSIT--DPPPTL
                                           :                              

A0A3B4G4Z6_MCL1-01      TGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPSTPE
A0A3B4ETX9_BCL2L10      SFCCTSPHQAPPPPSESAA-------------------------------
A0A3B4FNX1_BCL2L1-      DTHANGTFNGTSPGTPPASPQRRQQQPPSTTDLDAVK-------------
A0A3B4G3K4_BCL2-01      VHRCREASTGPDGESNTHLCRRLPQSDPHA----GIH-------------
                           .  .  .      .                                 

A0A3B4G4Z6_MCL1-01      FHSDSESDEQLERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADV
A0A3B4ETX9_BCL2L10      -----------------------------------------AMRRLGWDI
A0A3B4FNX1_BCL2L1-      ----------------------------------------EALRDTANEF
A0A3B4G3K4_BCL2-01      ----------------------------------------RVLREAGDEL
                                                                 .:.    :.

A0A3B4G4Z6_MCL1-01      LEKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIVSFMA
A0A3B4ETX9_BCL2L10      ERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVVSLFA
A0A3B4FNX1_BCL2L1-      ELRYARAFSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGLFA
A0A3B4G3K4_BCL2-01      ERLYQPDFTEMSRQLHLTSATAQ-RRFAEVIDELFRDG-VNWGRIIAFFE
                           :   :  :   : :         .  * ..:. *   ****::.:: 

A0A3B4G4Z6_MCL1-01      FGAVVSQHLKEK--GRDN-----------YVALVSQEISAYLLSEQRDWI
A0A3B4ETX9_BCL2L10      FTGVLARKILEQKPGLDPGQQQELGQEPMSCRRLAETIADYLGEEKKDWL
A0A3B4FNX1_BCL2L1-      FGGALCVECVEKE--MSP-----------LVGRIVEWMTVYLDNHIQPWI
A0A3B4G3K4_BCL2-01      FGGTVCVECASNE-GMSS-----------QVDNIADWMTEYLNGPLNSWI
                        * ..:.    .:    .                : : :: **    . *:

A0A3B4G4Z6_MCL1-01      VKNNAWDGFVEFFRVADPESIVRHTLMAFAGFAGIGATLALLISCWDALL
A0A3B4ETX9_BCL2L10      LDNDGWEGFCKFSR-SAREVSQDSSMK--KALFAAAGVGLAGLT---FLL
A0A3B4FNX1_BCL2L1-      QSQGGWERFAEIFG-QDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIA
A0A3B4G3K4_BCL2-01      QDNGGWDAFVELYD-RQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLT
                         .:..*: * ::            :          .      :     : 

A0A3B4G4Z6_MCL1-01      ----
A0A3B4ETX9_BCL2L10      VR--
A0A3B4FNX1_BCL2L1-      QKRL
A0A3B4G3K4_BCL2-01      QK--
                            

© 1998-2019