Dataset for protein Mcl-1 of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6GI15_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6GI15_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6F6N9_MCL1-01      ------DLWINLGISCGRADLGWAWLGL----------------------
A0A2K6GI15_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLL--------------
                              :  *.*.: ** *.** .  *                       

A0A2K6GI15_MCL1-01      GEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFA
A0A2K6GI15_MCL1-02      GEDGTVIGGSPGASPPASLTPEARRVARPAPIGAEVPDVTATPERLLFFA
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6GI15_MCL1-01      PTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
A0A2K6GI15_MCL1-02      PTRRALPSEEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6GI15_MCL1-01      SNGSSTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMG
A0A2K6GI15_MCL1-02      SNGSSTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPMG
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      ---------------------------------------ATGAKDAKPMG
                                                                          

A0A2K6GI15_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQGWVC-----------------
A0A2K6GI15_MCL1-02      RSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2K6F6N9_MCL1-01      -------------------------KAFQGMLQKLDIKNEDDVKSLSRVM
A0A2K6GI15_MCL1-03      RSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
                                                 .**** :                  

A0A2K6GI15_MCL1-01      --------------------GVLPCRGPRR-RHQKCAAGFCRCC------
A0A2K6GI15_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
A0A2K6F6N9_MCL1-01      VHVFSDSVTNWGRIVTLISFCAFVSKHLKTINQESCIEPLAESITDILVR
A0A2K6GI15_MCL1-03      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                                             .: ..  .  .::.*   :. .       

A0A2K6GI15_MCL1-01      ----W---SRSWFGISNKIAL-----------------------------
A0A2K6GI15_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K6F6N9_MCL1-01      TKRDWL-----------FFHVEDLEGSIRNVLLAFAGVAGVGAGLTYLIR
A0A2K6GI15_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                            *             : :                             

© 1998-2019