Dataset for protein BCL-2-like of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6GWN0_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2K6GI15_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6GI15_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSSGATPPGGRLLAAEKEATARREVGG
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K6G3I7_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLAQRGY
A0A2K6EKG1_BCL2A1-      ------------------------MTDCEFGYTHRLVQDYLQYVLRVP--
A0A2K6GWN0_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K6F2Q2_BCL2L10      ------------------------MGDRFRERTERLLADYLEYCTREPG-
A0A2K6F6N9_MCL1-01      ----------------------------------DLWINLGISC----G-
A0A2K6GI15_MCL1-03      ----------------------------MFGLKRNAVIGLNLYC----G-
                                                                          

A0A2K6GWN0_BCL2L2-      -QKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP
A0A2K6GI15_MCL1-01      GEDGTVIGGSPGASPPASLTPEARRVA-----------------------
A0A2K6GI15_MCL1-02      GEDGTVIGGSPGASPPASLTPEARRVA-----------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      SWSQFIDAEENRTEAPEATESEMETPS-----------------------
A0A2K6G3I7_BCL2-01      EW----DAGDAGAAPPGAAPTPGIFSS-----------------------
A0A2K6EKG1_BCL2A1-      -------------------------QP-----------------------
A0A2K6GWN0_BCL2L2-      VC---------------------GAGP-----------------------
A0A2K6F2Q2_BCL2L10      -------------------------AP-----------------------
A0A2K6F6N9_MCL1-01      -------------------------RA-----------------------
A0A2K6GI15_MCL1-03      -------------------------GA-----------------------
                                                                          

A0A2K6GWN0_BCL2L2-      GSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQV
A0A2K6GI15_MCL1-01      -----RPAPIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSP
A0A2K6GI15_MCL1-02      -----RPAPIGAEVPDVTATPERLLFFAPTRRALPSEEMEAPAADAIMSP
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6GWN0_BCL2L2-      QEWMVAYLETRLADWIHSSGGWELEAIKAR-----VREMEEEAEKLKELQ
A0A2K6GI15_MCL1-01      ED---------------ELDGYEPEPLGKRPAVLPLLELVGEASN----G
A0A2K6GI15_MCL1-02      ED---------------ELDGYEPEPLGKRPAVLPLLELVGEASN----G
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3I7_BCL2-01      --------------------------------------------------
A0A2K6EKG1_BCL2A1-      --------------------------------------------------
A0A2K6GWN0_BCL2L2-      --------------------------------------------------
A0A2K6F2Q2_BCL2L10      --------------------------------------------------
A0A2K6F6N9_MCL1-01      --------------------------------------------------
A0A2K6GI15_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6GWN0_BCL2L2-      NEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEA
A0A2K6GI15_MCL1-01      SSTDGSLPSTPPPAEEE------DDELYRQSLEIISRYLREQATGAKDAK
A0A2K6GI15_MCL1-02      SSTDGSLPSTPPPAEEE------DDELYRQSLEIISRYLREQATGAKDAK
A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      -------------------------AINGNPSWHLADSPPANGATGHSSS
A0A2K6G3I7_BCL2-01      -------------------------QPGRNPPPAAPRDPAARTSPPPAAA
A0A2K6EKG1_BCL2A1-      -------------------------GSGPSKTSR----------------
A0A2K6GWN0_BCL2L2-      -------------------------GEGPAADPL----------------
A0A2K6F2Q2_BCL2L10      -------------------------GLPPSSLEA----------------
A0A2K6F6N9_MCL1-01      -------------------------DLGWAWLGL----------------
A0A2K6GI15_MCL1-03      -------------------------GLGAGSSGATPPGGRLLATGAKDAK
                                                                          

A0A2K6GWN0_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A2K6GI15_MCL1-01      PMGRSGAASRKALETLRRVG-------------DGVQRN---HETAFQGW
A0A2K6GI15_MCL1-02      PMGRSGAASRKALETLRRVG-------------DGVQRN---HETAFQGM
A0A2K6G3C5_BCL2L1-      --------------MQKRTG-------------LRPQKR---LNRRWRPP
A0A2K6G3C5_BCL2L1-      LDAREVIPMAAVKQALKEAG-------------DEFELR---YRRAFSDL
A0A2K6G3I7_BCL2-01      AGPAPSPVPPVVHLTLRQAG-------------DDFSRR---YRRDFAEM
A0A2K6EKG1_BCL2A1-      --------------VLQNIA-------------FSVQNE---VEKNLKAC
A0A2K6GWN0_BCL2L2-      ------------HQAMRAAG-------------DEFETR---FRRTFSDL
A0A2K6F2Q2_BCL2L10      -------------AAMRFAA-------------TKIRRK---HASFFSAY
A0A2K6F6N9_MCL1-01      --------------------------------------------KAFQGM
A0A2K6GI15_MCL1-03      PMGRSGAASRKALETLRRVG-------------DGVQRN---HETAFQGM
                                                                          

A0A2K6GWN0_BCL2L2-      QIKVSLCFPLYILY-SQVIPKRTNRPGIST-------------TDRGFPR
A0A2K6GI15_MCL1-01      VC--------------------------------------GVLPCRGPRR
A0A2K6GI15_MCL1-02      LRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKS
A0A2K6G3C5_BCL2L1-      VPLMATHPGTAYQS-FEQVVNELFRDGVN-WGRIVAFFSFGGALCVESVD
A0A2K6G3C5_BCL2L1-      TSQLHITLGTAYQS-FEQVVNELFRDGVN-WGRIVAFFSFGGALCVESVD
A0A2K6G3I7_BCL2-01      SSQLHLTPFTARGR-FATVVEELFRDGVN-WGRIVAFFEFGGVMCVESVN
A0A2K6EKG1_BCL2A1-      LDNVNVASIDAARTIFNQVMEKEFEDGIVNWGRIVTVFAFGGILIKKLLR
A0A2K6GWN0_BCL2L2-      AAQLHVTPGSAQQR-FTQVSDELFQGGPN-WGRLVAFFVFGAALCAESVN
A0A2K6F2Q2_BCL2L10      VG----YPGNRVYL-LERMAEAVLCDSLS-WGRVVMLVTFAGTLLERGPP
A0A2K6F6N9_MCL1-01      LQKLDIKNEDDVKS-LSRVMVHVFSDSVTNWGRIVTLISFCAFVSKHLKT
A0A2K6GI15_MCL1-03      LRKLDIKNEDDVKS-LSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKS
                                                                          

A0A2K6GWN0_BCL2L2-      AR-------YRARTTN-----------YNSSR--------------SRFY
A0A2K6GI15_MCL1-01      -R-------HQKCAAG-----------FCRCC----------W---SRSW
A0A2K6GI15_MCL1-02      IN-------QESCIEP-----------LAESITDVLVRTKRDWLVKQRGW
A0A2K6G3C5_BCL2L1-      KE-------MQVLVSR-----------IATWMATYLNDHLEPWIQENGGW
A0A2K6G3C5_BCL2L1-      KE-------MQVLVSR-----------IATWMATYLNDHLEPWIQENGGW
A0A2K6G3I7_BCL2-01      RE-------MSPLVDN-----------IALWMTEYLNRHLHTWIQDNGGW
A0A2K6EKG1_BCL2A1-      EQIALDVDTYKE---------------ISYFIAEFITNNAGEWIRQNGGW
A0A2K6GWN0_BCL2L2-      KE-------MEPLVGQ-----------VQEWMVAYLETRLADWIHSSGGW
A0A2K6F2Q2_BCL2L10      VTAWWKKWGLQPQPKEGDPEVARDRQRLVALLCARLAGQHRAWLQAQGGW
A0A2K6F6N9_MCL1-01      IN---QESCIEP---------------LAESITDILVRTKRDWL------
A0A2K6GI15_MCL1-03      IN---QESCIEP---------------LAESITDVLVRTKRDWLVKQRGW
                                                                          

A0A2K6GWN0_BCL2L2-      S-GFNSRPRGRVYRGRAR------------ATSWYSPY------------
A0A2K6GI15_MCL1-01      F-GISNKIAL----------------------------------------
A0A2K6GI15_MCL1-02      D-GFVEFFHVEDLEGGIR------------NVLLAFAGVAGVGAGLAYLI
A0A2K6G3C5_BCL2L1-      D-TFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFS
A0A2K6G3C5_BCL2L1-      D-TFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFS
A0A2K6G3I7_BCL2-01      D-AFVELYGPSM-------RPLFDFSWLSLKTLLSLALVGACITLGAYLG
A0A2K6EKG1_BCL2A1-      EHGFVKKFEP-----------------R--PAWLTFLEVTGKICDMLSLL
A0A2K6GWN0_BCL2L2-      A-EFTALYGDGALEEARRLREGNWASVR--TVLTGAVALGALVTVGAFFA
A0A2K6F2Q2_BCL2L10      D-GFCDLFRKPLPL----------AVWR--RLLVQVLLSCFLATTVIYFW
A0A2K6F6N9_MCL1-01      ------FFHVEDLE----------GSIR--NVLLAFAGVAGVGAGLTYLI
A0A2K6GI15_MCL1-03      D-GFVEFFHVEDLE----------GGIR--NVLLAFAGVAGVGAGLAYLI
                                                                          

A0A2K6GWN0_BCL2L2-      ----
A0A2K6GI15_MCL1-01      ----
A0A2K6GI15_MCL1-02      R---
A0A2K6G3C5_BCL2L1-      RK--
A0A2K6G3C5_BCL2L1-      RK--
A0A2K6G3I7_BCL2-01      HK--
A0A2K6EKG1_BCL2A1-      YS--
A0A2K6GWN0_BCL2L2-      SK--
A0A2K6F2Q2_BCL2L10      TRLL
A0A2K6F6N9_MCL1-01      R---
A0A2K6GI15_MCL1-03      R---
                            

© 1998-2019