Dataset for protein Bcl-xL of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6G3C5_BCL2L1-      --------------------------------------------------
A0A2K6G3C5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFIDAEENRTEAPEATESEMETPSA
                                                                          

A0A2K6G3C5_BCL2L1-      --------------------------------------MQKRTGLRPQKR
A0A2K6G3C5_BCL2L1-      INGNPSWHLADSPPANGATGHSSSLDAREVIPMAAVKQALKEAGDEFELR
                                                                * :*   : *

A0A2K6G3C5_BCL2L1-      LNRRWRPPVPLMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2K6G3C5_BCL2L1-      YRRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                         .* :   .. :    **********************************

A0A2K6G3C5_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2K6G3C5_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        **************************************************

A0A2K6G3C5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2K6G3C5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2019