Dataset for protein BCL-2-like of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2N5Y9_MCL1-01          MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
H2NNZ9_BCL2A1-01        --------------------------------------------------
H2NN92_BCL2L10-01       --------------------------------------------------
A0A2J8VIH3_BCL2L1-      --------------------------------------------------
H2NWH5_BCL2-01          --------------------------------------------------
                                                                          

H2N5Y9_MCL1-01          GEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLFFFA
H2NNZ9_BCL2A1-01        ------------------------------MTDCEFGYIYRLAQDYLQYV
H2NN92_BCL2L10-01       --------------------------------MVDQLRERTITADLLRER
A0A2J8VIH3_BCL2L1-      ----------------------------------MSQSNRELVVDFLSYK
H2NWH5_BCL2-01          ----------------------------MAHAGTTGYDNREIVDEXIHYK
                                                                      :   

H2N5Y9_MCL1-01          PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
H2NNZ9_BCL2A1-01        LQIP----------------------------------------------
H2NN92_BCL2L10-01       TERLLADY------------------------------------------
A0A2J8VIH3_BCL2L1-      LSQKGYSWSQFSDVEENRTEAPE-----------GTESEMETPSAINGNP
H2NWH5_BCL2-01          LSQRGYEWD-----AGDVGAAPP-----------GAATAPGIFSSQPGHT
                                                                          

H2N5Y9_MCL1-01          GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPLG
H2NNZ9_BCL2A1-01        ------------QPGSGPSKASRVLQKVAFSVQKEVE-------------
H2NN92_BCL2L10-01       ---LGCCAREPGTPEPTPPTPEAAV-------------------------
A0A2J8VIH3_BCL2L1-      SWHLADSPAVNGATGHSSSLDAREVIPM-----AAVK-------------
H2NWH5_BCL2-01          PHPAASRDPARTSPLPTPAAPGAAVGPALSPVPPVVH-------------
                                     .                                    

H2N5Y9_MCL1-01          RSGATCRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
H2NNZ9_BCL2A1-01        ----------KNLKPCLDNVNVV--------------SVDTARTLFNQVM
H2NN92_BCL2L10-01       ------------LRSAAARLRQLHRSFFSAYLG----YPGNRVELVALMA
A0A2J8VIH3_BCL2L1-      ----------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
H2NWH5_BCL2-01          ----------LTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
                                    *.     .                         .  : 

H2N5Y9_MCL1-01          VHVFSDGVT-NWGRIVTLISFGAFVAKH----------------LKTINQ
H2NNZ9_BCL2A1-01        EKEFEDGII-NWGRIVTIFAFEGILI------------------KKLLRQ
H2NN92_BCL2L10-01       DSVLSDSPSPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEG
A0A2J8VIH3_BCL2L1-      NELFRDGVN--WGRIVAFFSFGGALC------------------VESVDK
H2NWH5_BCL2-01          EELFRDGVN--WGRIVAFFEFGGVMC------------------VESVNR
                           : *.    ***:*::. * . :                    :    

H2N5Y9_MCL1-01          ESCIE-----PLAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVEDLEGG
H2NNZ9_BCL2A1-01        QIAPDVDTYKEISYFVAEFVMNNTGGWIKQNGGWENGFVKKLEPK-----
H2NN92_BCL2L10-01       DVARDCQ---RLVALLSSRLVGQHRAWLQAQGGWD-GFCHFFRTPLPLAF
A0A2J8VIH3_BCL2L1-      EMQVLVS---RIAAWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAES
H2NWH5_BCL2-01          EMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM----
                        :          :   ::  :      *:  : **:  *            

H2N5Y9_MCL1-01          IR------------NVLLAFAGVAGVGAGLAYLIR--
H2NNZ9_BCL2A1-01        --------------SGWMTFEVTGKICEMLSLLKQYC
H2NN92_BCL2L10-01       WRKQLV--------QAFLSCLLTTAFIYLWTRLL---
A0A2J8VIH3_BCL2L1-      RKGQERFN------RWFLTGMTVAGVVLLGSLFSRK-
H2NWH5_BCL2-01          ---RPLFDFSWLSLKTLLSLALVGACITLGAYLGHK-
                                         ::   .       : :    

© 1998-2019