Dataset for protein BCL-2-like of organism Poecilia reticulata

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9Q4R7_MCL1-02      --------MTANSTTALNYLIFSQNGVGNGQTHYDQGLVVPEVAMGSRVE
A0A3P9Q4R7_MCL1-01      --------MTANSTTALNYLIFSQNGVGNGQTHYDQGLVVPEVAMGSRVE
A0A3P9N9Y4_BCL2L1-      --------MSRNRELVLFYIKFKLS-----QRNYPIQHILPN--------
A0A3P9NE65_BCL2L10      MRRGSPSAVWMCRE------PSHIA-----GRKMSCGLW-----------
A0A3P9QFB3_BCL2L1-      -------MSYSNRELVEFYISYKLS-----QRNYSSSLL-----------
                                                        :                 

A0A3P9Q4R7_MCL1-02      SLHSPMDPFKKRPTNLAVTASNGYVAKSLPESSDDSDEGSLPCTPAQQDG
A0A3P9Q4R7_MCL1-01      SLHSPMDPFKKRPTNLAVTASNGYVAKSLPESSDDSDEGSLPCTPAQQDG
A0A3P9N9Y4_BCL2L1-      --EPPDSTAARDAAGDGGMDDEQTLETHANGTFNGTSPGSPRRQQAASA-
A0A3P9NE65_BCL2L10      ------------------KETVAVAEDYIHLRCSNPHPAP----------
A0A3P9QFB3_BCL2L1-      ------------------RSEADGARTNWDGDSRGPSNGPLVNSRAGSRG
                                                          ..  ..          

A0A3P9Q4R7_MCL1-02      ETDASAVRASNQVLDNDTTELISSFLRNFTGLSKC--RWSQNKALSTMKR
A0A3P9Q4R7_MCL1-01      ETDASAVRASNQVLDNDTTELISSFLRNFTGLSKC--RWSQNKALSTMKR
A0A3P9N9Y4_BCL2L1-      ----STMDAVKVTLRDTAREFELRYSRAFNDLHST-LHITPATAYQSFEN
A0A3P9NE65_BCL2L10      ----PPPSEPAAAMRRLAQDVEAQHQARFHSLAQGFLKHCGTDLCSNLRK
A0A3P9QFB3_BCL2L1-      KSQGPPVEVVKSVLKDAAEEFERLYTQSFKHLSLQ-LDITPDTAYHSFKT
                            ..      .:   : :.   .   *  *              .:  

A0A3P9Q4R7_MCL1-02      VVEDVLSKHRYAYNGMLSKLALDNQPDNMGFVTEVAESLFSDGTTNWGRI
A0A3P9Q4R7_MCL1-01      VVEDVLSKHRYAYNGMLSKLALDNQPDNMGFVTEVAESLFSDGTTNWGRI
A0A3P9N9Y4_BCL2L1-      VMDE----------------------------------VFRDG-VNWGRI
A0A3P9NE65_BCL2L10      VMDE----------------------------------MVGDGHFNWGRV
A0A3P9QFB3_BCL2L1-      VLDE----------------------------------LF-KGEVNWGRV
                        *:::                                  :. .*  ****:

A0A3P9Q4R7_MCL1-02      VSLVAFGAVVCQHLKERGREHCVDL---------------------VSQE
A0A3P9Q4R7_MCL1-01      VSLVAFGAVVCQHLKERGREHCVDL---------------------VSQE
A0A3P9N9Y4_BCL2L1-      VGLFAFGGALCVECVEKEMSHLVAR---------------------IVEW
A0A3P9NE65_BCL2L10      VSLFAFAGVLA-----RQLREQTGKNPGPDSGKQQELQQETVSCRALAET
A0A3P9QFB3_BCL2L1-      VAMFTFGGILCVDCVQKNMSELVSR---------------------IAEW
                        *.:.:*.. :.     .     .                       : : 

A0A3P9Q4R7_MCL1-02      ISTYLLAKQRDWLAKNNSWEGFVEF---FRVSDPESTVRNTLMAFVGVAG
A0A3P9Q4R7_MCL1-01      ISTYLLAKQRDWLAKNNSWEGFVEF---FRVSDPESTVRNTLMAFVGVAG
A0A3P9N9Y4_BCL2L1-      MTVYLDERIEPWVESQGGWERFAEI-FGGNAAAESRRSQESFKNWLLL-G
A0A3P9NE65_BCL2L10      IADYLEKHKKDWLQENNGWDGFCSYALNAREVSQDSSMKTALVAVAGV-G
A0A3P9QFB3_BCL2L1-      MTTYLDEQLNPWIQSQGGWDHFANL-YGQDAAAEGRRFRETLNKWLLV-G
                        :: **  .   *: .:..*: * .              . ::     : *

A0A3P9Q4R7_MCL1-02      IGATLAFLI-------R-
A0A3P9Q4R7_MCL1-01      IGATLAFLI-------SK
A0A3P9N9Y4_BCL2L1-      MSVVTAFIAGSIFAQKRL
A0A3P9NE65_BCL2L10      IAGLTFLLV-------R-
A0A3P9QFB3_BCL2L1-      VALLTGALLVMFIAKKR-
                        :.     :          

© 1998-2019