Dataset for protein Bcl-xL of organism Poecilia reticulata

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9N9Y4_BCL2L1-      -MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTAARDAAGDGGMDDE
A0A3P9QFB3_BCL2L1-      MSYSNRELVEFYISYKLSQRNYS-SSLLRSEADGARTNWDGDSRG-----
                            ***** ***.:*******. . :* .*. .: : .*. . *     

A0A3P9N9Y4_BCL2L1-      QTLETHANGTFNGTSPGSPRRQQAASASTMDAVKVTLRDTAREFELRYSR
A0A3P9QFB3_BCL2L1-      -----PSNGPLVNSRAGSRGKSQGPP---VEVVKSVLKDAAEEFERLYTQ
                              :**.: .: .**  ..*...   ::.** .*.*:* ***  *:.

A0A3P9N9Y4_BCL2L1-      AFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVE
A0A3P9QFB3_BCL2L1-      SFKHLSLQLDITPDTAYHSFKTVLDELFKGEVNWGRVVAMFTFGGILCVD
                        :*: *   * *** ***:**:.*:**:*.. *****:*.:*:*** ***:

A0A3P9N9Y4_BCL2L1-      CVEKEMSHLVARIVEWMTVYLDERIEPWVESQGGWERFAEIFGGNAAAES
A0A3P9QFB3_BCL2L1-      CVQKNMSELVSRIAEWMTTYLDEQLNPWIQSQGGWDHFANLYGQDAAAEG
                        **:*:** **:**.****.****.::**::*****:.**:::* :****.

A0A3P9N9Y4_BCL2L1-      RRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
A0A3P9QFB3_BCL2L1-      RRFRETLNKWLLVGVALLTGALLVMFIAKKR-
                        ** .*::::***:*::::*. :   ::*:** 

© 1998-2019