Dataset for protein BCL-2-like of organism Poecilia mexicana

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3YCD0_MCL1-01      --------MTANSTTALNYLIFSQNGVGDGQTHYDQGLVVPEVAMGATVD
A0A3B3WI27_BCL2L1-      --------MSRNRELVLFYIKFKLS-----QRNYPIQHILPNEPPDSTAA
A0A3B3XN57_BCL2L1-      -------MSYSNRELVEFYISYKLS-----QRNYSSSLL-----------
A0A3B3YT99_BCL2L10      MHRGSPSAVWMCRE------PSHIA-----GRKMSCGLW-----------
                                                        :                 

A0A3B3YCD0_MCL1-01      SLHSPKDPYKQRPTNLAVTASNGYVAKSLQKSSDDSDEGSLPCTPAQQDS
A0A3B3WI27_BCL2L1-      GDAAGDAGMDD------EQTLETHANGTFNGTSPGS--------PRRQQA
A0A3B3XN57_BCL2L1-      --------RSE------ADGARTNWDGDSRGPSNGPLVNSWAGSPGKSQD
A0A3B3YT99_BCL2L10      --------KET------VAVAEDYIHLRCSSPHPAP--------PPPSEP
                                 .                     .   .        *  .: 

A0A3B3YCD0_MCL1-01      ETDASAVRASNQVLDNDTMELISSFLRHFTGLSKCRWSQNKALSTMKRVV
A0A3B3WI27_BCL2L1-      ASAA-------------------------------------TMDAVKVTL
A0A3B3XN57_BCL2L1-      P-PT-------------------------------------GVEVVKSVL
A0A3B3YT99_BCL2L10      A-AA-------------------------------------MRRLAQDVE
                           :                                          : . 

A0A3B3YCD0_MCL1-01      EDVLSKHRYAYNGMLNRLALD---NQPDNMGFVTEVAENLFSDGTTNWGR
A0A3B3WI27_BCL2L1-      RDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDG-VNWGR
A0A3B3XN57_BCL2L1-      KDAAEEFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELF-KGEVNWGR
A0A3B3YT99_BCL2L10      AQHQARFHSLAQGFLKHCGTDL-------CSNLRKVMDEMVGDGHFNWGR
                         :    .       ::                .  * :::. .*  ****

A0A3B3YCD0_MCL1-01      IVSLVAFGAAVCQHLKERGREHCVEL---------------------VSK
A0A3B3WI27_BCL2L1-      IVGLFAFGGALCVECVEKEMSHLVAR---------------------IVE
A0A3B3XN57_BCL2L1-      VVAMFTFGGILCVDCVQKNMSELVSR---------------------IAE
A0A3B3YT99_BCL2L10      VVSLFAFAGVLA-----RQLREQTGKNPGPDSGKQQELQQEPVSCRALAE
                        :*.:.:*.. :.     .     .                       : :

A0A3B3YCD0_MCL1-01      EISTYLLENQRDWLAKNNSWEGFVEF---FRVSDPESTVRNTLMAFVGVA
A0A3B3WI27_BCL2L1-      WMTVYLDERIEPWVESQGGWDRFAEI-FGGNAAAESRRSQESFKNWLLL-
A0A3B3XN57_BCL2L1-      WMTTYLDEQLNPWIQSQGGWDRFANL-YGQDAAAEGRRFRETLNKWLLV-
A0A3B3YT99_BCL2L10      TIADYLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGV-
                         :: ** :.   *: .:..*: * .              . ::     : 

A0A3B3YCD0_MCL1-01      GIGATLAFLI-------R-
A0A3B3WI27_BCL2L1-      GMSVVTAFIAGSIFAQKRL
A0A3B3XN57_BCL2L1-      GVALLTGALLVMFVAKKR-
A0A3B3YT99_BCL2L10      GIAGLTFLLV-------R-
                        *:.     :        * 

© 1998-2019