Dataset for protein BCL-2-like of organism Poecilia latipinna

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3VM25_MCL1-01      --------MTANSTTALNYLIFSQNGVGDGQTHYDQGLVVPEVAMGATVD
A0A3B3TUS7_BCL2L1-      --------MSRNRELVLFYIKFKLS-----QRNYPIQHILP---------
A0A3B3TYN4_BCL2L10      MHRGSPSAVWMCRE------PSHIA-----GRKMSCGLW-----------
A0A3B3VWI7_BCL2L1-      -------MSYSNRELVEFYISYKLS-----QRNYSSSLL-----------
                                                        :                 

A0A3B3VM25_MCL1-01      SLHSPKDPYKQRPTNLAVTASNGYVAKSLQESSDEGSLPCT--------P
A0A3B3TUS7_BCL2L1-      --NEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGS--------P
A0A3B3TYN4_BCL2L10      -------------------KETVAVAEDYIRLCCSSPHPAP--------P
A0A3B3VWI7_BCL2L1-      -------------------RSEADGARTNWDGDSRGPSNGPLVNSWAGSP
                                            .              ..   .        *

A0A3B3VM25_MCL1-01      AQQDSETVASAVRASNQVLDNDTMELIGSFLRNFTGLSKCRWSQNKALST
A0A3B3TUS7_BCL2L1-      RRQQAASAA-------------------------------------TMDA
A0A3B3TYN4_BCL2L10      PPSEPA-AA-------------------------------------MRRL
A0A3B3VWI7_BCL2L1-      GKSRDP-PT-------------------------------------GVKV
                          .     :                                         

A0A3B3VM25_MCL1-01      MKRVVEDVLSKHRYAYNGMLNRLALD---NQPDNMGFVTEVAQNLFSDGT
A0A3B3TUS7_BCL2L1-      VKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSFENVMDEVFRDG-
A0A3B3TYN4_BCL2L10      AQDVEAQHQARFHSLAQGFLKHCGTDL-------CSNLRKVMDEMVGDGH
A0A3B3VWI7_BCL2L1-      VKLVLKDAAEEFERLYTQSFKHLSLQLDITPDTAYQSFKTVLDELF-KGE
                         : .  :    .       ::                .  * :::. .* 

A0A3B3VM25_MCL1-01      TNWGRIVSLVAFGAAVCQHLKERGREHCVEL-------------------
A0A3B3TUS7_BCL2L1-      VNWGRIVGLFAFGGALCVECVEKEMSHLVAR-------------------
A0A3B3TYN4_BCL2L10      FNWGRVVSLFAFAGVLA-----RQLREQTGKNPGPDSGKQQELQQEPVSC
A0A3B3VWI7_BCL2L1-      VNWGRVVAMFTFGGILCVDCVQKNMSELVSR-------------------
                         ****:*.:.:*.. :.     .     .                     

A0A3B3VM25_MCL1-01      --VIQEISTYLLENQRDWLAKNNSWEGFVEF---FRVSDPESTVRNTLMA
A0A3B3TUS7_BCL2L1-      --IVEWMTVYLDERIEPWVESQGGWDRFAEI-FGGNAAAESRRSQESFKN
A0A3B3TYN4_BCL2L10      RALAETIADYLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVA
A0A3B3VWI7_BCL2L1-      --IAEWMTTYLDEQLNPWIQSQGGWDRFANL-YGQDAAAEGRRFRETLNK
                          : : :: ** :.   *: .:..*: * .              . ::  

A0A3B3VM25_MCL1-01      F--VGVAGIGATLAFLIRKLRSALGQQKLNTSLLEMRDCTSLEPG
A0A3B3TUS7_BCL2L1-      WLLLGMSVVTAFIAGSIFAQKRL----------------------
A0A3B3TYN4_BCL2L10      VAGVGIAGLTFLLV-------R-----------------------
A0A3B3VWI7_BCL2L1-      WLLVGVALLTGALLVMFVAKKR-----------------------
                           :*:: :   :                                

© 1998-2019