Dataset for protein Bcl-xL of organism Poecilia latipinna

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3TUS7_BCL2L1-      -MSRNRELVLFYIKFKLSQRNYPIQHILPNEPPDSTA-AGDAAGDAGMDD
A0A3B3VWI7_BCL2L1-      MSYSNRELVEFYISYKLSQRNYSSSLLRSEADGARTNWDGDSRGP-----
                            ***** ***.:*******. . : .:     *   **: *      

A0A3B3TUS7_BCL2L1-      EQTLETHANGTFNGTSPGSPRRQQAASAATMDAVKVTLRDTAREFELRYS
A0A3B3VWI7_BCL2L1-      -------SNGPLVNSWAGSPGKSRDPPTG-VKVVKLVLKDAAEEFERLYT
                               :**.: .: .*** ... ..:. :..**:.*.*:* ***  *:

A0A3B3TUS7_BCL2L1-      RAFNDLHSTLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCV
A0A3B3VWI7_BCL2L1-      QSFKHLSLQLDITPDTAYQSFKTVLDELFKGEVNWGRVVAMFTFGGILCV
                        .:*: *   * *** ******:.*:**:*.. *****:*.:*:*** ***

A0A3B3TUS7_BCL2L1-      ECVEKEMSHLVARIVEWMTVYLDERIEPWVESQGGWDRFAEIFGGNAAAE
A0A3B3VWI7_BCL2L1-      DCVQKNMSELVSRIAEWMTTYLDEQLNPWIQSQGGWDRFANLYGQDAAAE
                        :**:*:** **:**.****.****.::**::*********:::* :****

A0A3B3TUS7_BCL2L1-      SRRSQESFKNWLLLGMSVVTAFIAGSIFAQKRL
A0A3B3VWI7_BCL2L1-      GRRFRETLNKWLLVGVALLTGALLVMFVAKKR-
                        .** .*::::***:*::::*. :   :.*:** 

© 1998-2019