Dataset for protein BCL-2-like of organism Poecilia formosa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A087X830_MCL1-01      MTANSTTALNYLIFSQNGVGDGQTHYDQGLVVPEVAMGATVDSLHSPKDP
A0A087X9B7_BCL2L1-      -----------------------MSRNRELVLFYIKFKLSQRNYPIQHIL
A0A087YBW4_BCL2L1-      ----------------------MSYSNRELVEFYISYKLSQRNYSSSLL-
A0A096ME02_BCL2L10      ---------------MHRGSPSAVWMCRE------PSHIAGRKMSCGLW-
                                                   .           :  .       

A0A087X830_MCL1-01      YKKRPTNLAVSASNGYVAKSLQKSSDDSDEGSLPCTP-----------AQ
A0A087X9B7_BCL2L1-      PNEPPDSTAAGDAAGDAGMDDEQTLETHANGTFNGTSPGS--------PR
A0A087YBW4_BCL2L1-      ------------------RSEADGARTNWDGDSRGPSNGPLVNSWAGSPG
A0A096ME02_BCL2L10      ------------------KETVAVAEDYIHLRCSSPHPAP--------PP
                                           .               .            . 

A0A087X830_MCL1-01      QDSETDASAVRASNQVLDNDTMELISSFLRNFTGLS-KCRWSQNKALSTM
A0A087X9B7_BCL2L1-      RQQAASAATMDAVKVTLRDTAREFELRYSRAFNDLHSTLHITPATAYQSF
A0A087YBW4_BCL2L1-      KSRDP-PTGVKVVKLVLKDAAEEFERLYTQSFKHLSLQLDITPDTAYQSF
A0A096ME02_BCL2L10      PSEPA-AAMRRLAQDVEAQHQARFHSLAQGFLKHCGTDL-------CSNL
                         .  . .:     : .  :    :       :.              ..:

A0A087X830_MCL1-01      KRVVEDVLSKHRYAYNGMLNRLALDNQPDNMGFVTEVAENLFSDGTTNWG
A0A087X9B7_BCL2L1-      ENVMDE----------------------------------VFRDG-VNWG
A0A087YBW4_BCL2L1-      KTVLDE----------------------------------LF-KGEVNWG
A0A096ME02_BCL2L10      RKVMDE----------------------------------MVGDGHFNWG
                          *:::                                  :. .*  ***

A0A087X830_MCL1-01      RIVSLVAFGAAVCQHLKERGREHCVEL---------------------VS
A0A087X9B7_BCL2L1-      RIVGLFAFGGALCVECVEKEMSHLVAR---------------------IV
A0A087YBW4_BCL2L1-      RVVAMFTFGGILCVDCVQKNMSELVSR---------------------IA
A0A096ME02_BCL2L10      RVVSLFAFAGVLA-----RQLREQTGKNPGPDSGKQQELQQEPVSCRALA
                        *:*.:.:*.. :.     .     .                       : 

A0A087X830_MCL1-01      KEISTYLLENQRDWLAKNNSWEGFVEF---FRVSDPESTVRNTLMAFVGV
A0A087X9B7_BCL2L1-      EWMTVYLDERIEPWVESQGGWDRFAEI-FGGNAAAESRRSQESFKNWLLL
A0A087YBW4_BCL2L1-      EWMTTYLDEQLNPWIQSQGGWDRFANL-YGQDAAAEGRRFRETLNKWLLV
A0A096ME02_BCL2L10      ETIADYLEKHKKDWLQENNGWDGFCSYAHNAREVSQDSSMKTALVAVAGV
                        : :: ** :.   *: .:..*: * .              . ::     :

A0A087X830_MCL1-01      AGIGATLAFLI-------R-
A0A087X9B7_BCL2L1-      -GMSVVTAFIAGSIFAQKRL
A0A087YBW4_BCL2L1-      -GVALLTGALLVMFVAKKR-
A0A096ME02_BCL2L10      -GIAGLTFLLV-------R-
                         *:.     :        * 

© 1998-2019