Dataset for protein Mcl-1 of organism Periophthalmus magnuspinnatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4AFB7_MCL1-01      -----------------------------DTTC----------LQGVLTP
A0A3B4AFB7_MCL1-02      MNIINSPKRTALKLSTMGLFLPQNGLAEGDMHCGAADSSAQMPRPATMDT
                                                     *  *            ..: .

A0A3B4AFB7_MCL1-01      PLGTAHICGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
A0A3B4AFB7_MCL1-02      RKGNTASSGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
                          *.:  .******************************************

A0A3B4AFB7_MCL1-01      SEMELSSYSAEHEVLESDTRQLLSDFFKLFTGISQPKWKQRPALSTMKGV
A0A3B4AFB7_MCL1-02      SEMELSSYSAEHEVLESDTRQLLSDFFKLFTGISQPKWKQRPALSTMKGV
                        **************************************************

A0A3B4AFB7_MCL1-01      VDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRIA
A0A3B4AFB7_MCL1-02      VDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTTNWGRIA
                        **************************************************

A0A3B4AFB7_MCL1-01      SLIAFGAVVCQYLKTKGRESCVERVGQEISSYLLLDQRDWLVRNNAWDGF
A0A3B4AFB7_MCL1-02      SLIAFGAVVCQYLKTKGRESCVERVGQEISSYLLLDQRDWLVRNNAWDGF
                        **************************************************

A0A3B4AFB7_MCL1-01      VDFFRVEDPESAVRNTLMAVAGLAGIGATLAMLIR
A0A3B4AFB7_MCL1-02      VDFFRVEDPESAVRNTLMAVAGLAGIGATLAMLIR
                        ***********************************

© 1998-2019