Dataset for protein BCL-2-like of organism Periophthalmus magnuspinnatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4AAV4_BCL2L10      --------------------------------------------------
A0A3B4AFB7_MCL1-02      MNIINSPKRTALKLSTMGLFLPQNGLAEGDMHCGAADSSAQMPRPATMDT
A0A3B4AFB7_MCL1-01      ---------------------------------------DTTCLQGVLTP
A0A3B4A3G8_BCL2-01      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B3ZN55_BCL2L1-      --------------------------------------------------
A0A3B4BFZ8_BCL2L1-      --------------------------------------------------
                                                                          

A0A3B4AAV4_BCL2L10      ------MSCGLWKETLALAEDY----------------------------
A0A3B4AFB7_MCL1-02      RKGNTASSGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
A0A3B4AFB7_MCL1-01      PLGTAHICGSPHPRPTALVMKNELLNKNTREEDYENSEGSLPCTPEFHSD
A0A3B4A3G8_BCL2-01      ------MANDCNRNIVEKYICHKLSKRGFAWGFHEDAEDEGDVANN---G
A0A3B3ZN55_BCL2L1-      --------MSLNRELVEFYIQYKLSQRDCP--LQHLGLGDRSTQSD---T
A0A3B3ZN55_BCL2L1-      --------MSLNRELVEFYIQYKLSQRDCP--LGLEDGTEIDTERD---R
A0A3B4BFZ8_BCL2L1-      -------MSPSNRELVEFFISYKLSQKNYPSSLLMSDPARVQCEGN---K
                                   .                                      

A0A3B4AAV4_BCL2L10      ----------------------------LSLCCSGPQAAPPP---PSGSA
A0A3B4AFB7_MCL1-02      SEMELSSYSAEHEVLESDTRQLLSDFFKLFTGISQPKWKQRP------AL
A0A3B4AFB7_MCL1-01      SEMELSSYSAEHEVLESDTRQLLSDFFKLFTGISQPKWKQRP------AL
A0A3B4A3G8_BCL2-01      SIVASSPVLVNR-------------------RCRAERLCSAPSDPHAAIH
A0A3B3ZN55_BCL2L1-      EHLGLGDRGVDRARLQRETEVDSTELRLDSASDSAPVHSPAPLLDLDAVK
A0A3B3ZN55_BCL2L1-      DLLGLGDRSVDR------------------NSTPSLRLRL---DSASDSA
A0A3B4BFZ8_BCL2L1-      AANVPNGMLTNR------------------NGNRQTLASLPPDDHLDAIK
                                                                          

A0A3B4AAV4_BCL2L10      SAMRRLGQDMEAQHKARFHSLSQTFLKQCGPDPCSSLRKVMEELVGDGHL
A0A3B4AFB7_MCL1-02      STMKGVVDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTT
A0A3B4AFB7_MCL1-01      STMKGVVDKLLEKHRYAYNGMINKLALDDRGDDVSFIGTVAKSIFEDGTT
A0A3B4A3G8_BCL2-01      RVLREAGDELERLYQPDFTEMSRQLYLTSSTAQRRF-AEVIDELFRDG-V
A0A3B3ZN55_BCL2L1-      EALRDSANEFELRFSRAFSDLHRQLHITPATAYQSF-ESVMDEVFRDG-V
A0A3B3ZN55_BCL2L1-      PALRDSANEFELRFSRAFSDLHRQLHITPATAYQSF-ESVMDEVFRDG-V
A0A3B4BFZ8_BCL2L1-      TALTDSADEFEELFTQAFSNLSSQLDITPDTAYNSF-KSVMDEVFKDG-V
                         .:    :.:   .   :  :   :              * ..:. **  

A0A3B4AAV4_BCL2L10      NWGRVVSLFTFAGVLARHIKEQKSSRPGLDPGQVQGLGQVPSDCRRLAQT
A0A3B4AFB7_MCL1-02      NWGRIASLIAFGAVVCQYLKTK---------------G-RESCVERVGQE
A0A3B4AFB7_MCL1-01      NWGRIASLIAFGAVVCQYLKTK---------------G-RESCVERVGQE
A0A3B4A3G8_BCL2-01      NWGRIIAFFEFGGTVCVECASK---------------EDMSSQVDNIADW
A0A3B3ZN55_BCL2L1-      NWGRVVGLFAFGGALAVECVDK---------------E-MSTLVARIVTW
A0A3B3ZN55_BCL2L1-      NWGRVVGLFAFGGALAVECVDK---------------E-MSTLVARIVTW
A0A3B4BFZ8_BCL2L1-      NWGRIVGLFVFGGVLSVECVEK---------------D-MSILVPRIANW
                        ****: .:: *...:.     :                       .:   

A0A3B4AAV4_BCL2L10      IADYLGEEKRDWLLENGGWVGFCEF---SCHARKVDQDSSMKTALFAAAG
A0A3B4AFB7_MCL1-02      ISSYLLLDQRDWLVRNNAWDGFVDFFRVEDPESAVRNT-------LMAVA
A0A3B4AFB7_MCL1-01      ISSYLLLDQRDWLVRNNAWDGFVDFFRVEDPESAVRNT-------LMAVA
A0A3B4A3G8_BCL2-01      MTEYLNGTLSSWIQDNGGWEAFVELYDRQRDSVFSCSWPSIKTVFGLAAI
A0A3B3ZN55_BCL2L1-      MTVYLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMT
A0A3B3ZN55_BCL2L1-      MTVYLDEHIQDWIDSQGGWARFAEIYGQDAAAQSRHSEERFKKWLFAGMT
A0A3B4BFZ8_BCL2L1-      MTIYLDENIATWIQNQGGWASFAQIFGQNAAGEARRSRETLKKWLLVGVG
                        :: **      *:  :..*  * ::   .       .          .  

A0A3B4AAV4_BCL2L10      --VGLAGLTFLLVR--
A0A3B4AFB7_MCL1-02      GLAGIGATLAMLIR--
A0A3B4AFB7_MCL1-01      GLAGIGATLAMLIR--
A0A3B4A3G8_BCL2-01      GAASLTIGAYLSQK--
A0A3B3ZN55_BCL2L1-      LVTGVVVGSLLAQRRL
A0A3B3ZN55_BCL2L1-      LVTGVVVGSLLAQRRL
A0A3B4BFZ8_BCL2L1-      LLAGVLVAMLIAKK--
                          ..:     :  .  

© 1998-2019