Dataset for protein Bcl-xL of organism Periophthalmus magnuspinnatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3ZN55_BCL2L1-      -MSLNRELVEFYIQYKLSQRDCP--LQHLGLGDRSTQSDTEHLGLGDRGV
A0A3B3ZN55_BCL2L1-      -MSLNRELVEFYIQYKLSQRDCP--LGLEDGTEIDTERDRDLLGLGDRSV
A0A3B4BFZ8_BCL2L1-      MSPSNRELVEFFISYKLSQKNYPSSLLMSDPARVQCEGNKAANVPNGMLT
                          . *******:*.*****.: *  *   .    . : :      ..  .

A0A3B3ZN55_BCL2L1-      DRARLQRETEVDSTELRLDSASDSAPVHSPAPLLDLDAVKEALRDSANEF
A0A3B3ZN55_BCL2L1-      DR------------------NSTPSLRLRL---DSASDSAPALRDSANEF
A0A3B4BFZ8_BCL2L1-      NR------------------NGNRQTLASLPPDDHLDAIKTALTDSADEF
                        :*                   .              .    ** ***:**

A0A3B3ZN55_BCL2L1-      ELRFSRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFG
A0A3B3ZN55_BCL2L1-      ELRFSRAFSDLHRQLHITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFG
A0A3B4BFZ8_BCL2L1-      EELFTQAFSNLSSQLDITPDTAYNSFKSVMDEVFKDGVNWGRIVGLFVFG
                        *  *:.***:*  ** *** ***:**:*******.*******:****.**

A0A3B3ZN55_BCL2L1-      GALAVECVDKEMSTLVARIVTWMTVYLDEHIQDWIDSQGGWARFAEIYGQ
A0A3B3ZN55_BCL2L1-      GALAVECVDKEMSTLVARIVTWMTVYLDEHIQDWIDSQGGWARFAEIYGQ
A0A3B4BFZ8_BCL2L1-      GVLSVECVEKDMSILVPRIANWMTIYLDENIATWIQNQGGWASFAQIFGQ
                        *.*:****:*:** **.**..***:****:*  **:.***** **:*:**

A0A3B3ZN55_BCL2L1-      DAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
A0A3B3ZN55_BCL2L1-      DAAAQSRHSEERFKKWLFAGMTLVTGVVVGSLLAQRRL
A0A3B4BFZ8_BCL2L1-      NAAGEARRSRETLKKWLLVGVGLLAGVLVAMLIAKK--
                        :**.::*.* * :****:.*: *::**:*. *:*:.  

© 1998-2019