Dataset for protein BCL-2-like of organism Pelodiscus sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7FPN7_MCL1-01        --------------------------------------------------
K7G130_BCL2A1-01      ----------MESSEFRYVYYLV------------QDYLKYILQEPE---
K7F655_BCL2L1-01      ------MSNTNRELVIDFLSYKLSQRGHSWSWFEGEDEIRTEAAEEAEMA
K7F5Y4_BCL2-03        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPA--A
K7F5Y4_BCL2-01        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPA--A
K7F5Y4_BCL2-02        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPA--A
                                                                        

K7FPN7_MCL1-01        --------------------------------------------------
K7G130_BCL2A1-01      ------------------------------LGPAPSRVAHVLRNSASFLQ
K7F655_BCL2L1-01      SVPNGSPSWHPGASHVVNGAAGHSNSLEAHERVPAAEVRQALREAGDEFE
K7F5Y4_BCL2-03        -----------------GSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFS
K7F5Y4_BCL2-01        GTPSDHAGLVSLPPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFS
K7F5Y4_BCL2-02        GTPSDHAGLVSLPPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFS
                                                                        

K7FPN7_MCL1-01        --------GMLRKLDIKNEEDLKS-VSSVATHVFSDGITNWGRIVTLISF
K7G130_BCL2A1-01      KENEEILKPCLDTLDITSVDAARRIFIQVMDKEFDDGNTNWGRILTIFMF
K7F655_BCL2L1-01      LRYRRAFSDLTSQLHITLGTAYQS-FEQVVNELFRDG-VNWGRIVAFFSF
K7F5Y4_BCL2-03        RRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-INWGRIVAFFEF
K7F5Y4_BCL2-01        RRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-INWGRIVAFFEF
K7F5Y4_BCL2-02        RRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-INWGRIVAFFEF
                                   * :.        .  *    * **  *****:::: *

K7FPN7_MCL1-01        GAFVAKHLKSINQENCINT---LAGIITDVLVSDKRDWLVNQRGWEGFVE
K7G130_BCL2A1-01      GGILSKRLQEHKVQLTGDNKEQISYFITEYIINTKAEWIDANGGWE----
K7F655_BCL2L1-01      GGALCVESVDKEMQVLVGR---IASWMTTYLTDHLDPWIQENGGWERFVD
K7F5Y4_BCL2-03        GGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQDNGGW-----
K7F5Y4_BCL2-01        GGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQDNGGWDAFVE
K7F5Y4_BCL2-02        GGVMCVESVNREMSPLVDS---IAVWMTEYLNRHLHNWIQDNGGWAGAVS
                      *. :.    . : .   .    ::  :*  :      *:  : **     

K7FPN7_MCL1-01        FF---------------RVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
K7G130_BCL2A1-01      ---NGFLPMFEEKQSWLSLFNIKAKIMDAFSFFSQYY-----------
K7F655_BCL2L1-01      LYGNDAAAKSRKGQEQFNRGLLTGATVAGVLLLGSLLSRK--------
K7F5Y4_BCL2-03        ------------------------------------------------
K7F5Y4_BCL2-01        LYGSNMRPLFDFSWISL-KTILSLALVGACITLGAYLGHK--------
K7F5Y4_BCL2-02        VL----------------------------------------------
                                                                      

© 1998-2019