Dataset for protein Bcl-2 of organism Pelodiscus sinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7F5Y4_BCL2-03      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAA------------
K7F5Y4_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSL
K7F5Y4_BCL2-02      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSSSLSPPAAGTPSDHAGLVSL
                    ************************************************            

K7F5Y4_BCL2-03      -----GSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
K7F5Y4_BCL2-01      PPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
K7F5Y4_BCL2-02      PPEPPGSAAASNVPLGDGLRSAPQAVHLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTAR
                         *******************************************************

K7F5Y4_BCL2-03      GRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHN
K7F5Y4_BCL2-01      GRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHN
K7F5Y4_BCL2-02      GRFVAVVEELFRDGINWGRIVAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHN
                    ************************************************************

K7F5Y4_BCL2-03      WIQDNGGW--------------------------------------------
K7F5Y4_BCL2-01      WIQDNGGWDAFVELYGSNMRPLFDFSWISLKTILSLALVGACITLGAYLGHK
K7F5Y4_BCL2-02      WIQDNGGWAGAVSVL-------------------------------------
                    ********                                            

© 1998-2019