Dataset for protein Mcl-1 of organism Paramormyrops kingsleyae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3R4U0_MCL1-01      MNLINRTTATGL-----FCPGIKNGVKQNGFYSFV-----SASLPVAPLK
A0A3B3SG34_MCL1-01      MNPQSLKSYAPIMVSMNYHRPLHHGVLGKSILQCLDSSARAANTPCLESS
                        **  . .: : :     :   :::**  :.: . :     :*. *    .

A0A3B3R4U0_MCL1-01      AKSEEELDS-LDEGERFHGAPKTERRDCEH------HLRASGNEDGSLPS
A0A3B3SG34_MCL1-01      GLWDDELDNCTDEVDVCPCSTRLAKRDSEKEPCRGSRLPGSTNAVGSLPT
                        .  ::***.  ** :    :..  .**.*:      .* .* *  ****:

A0A3B3R4U0_MCL1-01      TP-GTPPDCGKMLTFPNRG---LSQETHELIGTFLRTYSGLPAS-ASRHK
A0A3B3SG34_MCL1-01      SPDGDLPAYGPICGFSRSAVEMLDQETSELITTFFAEYTGLCATLQRRNE
                        :* *  *  * :  *.. .   *.*** *** **:  *:** *:   *::

A0A3B3R4U0_MCL1-01      AYPVLRRVAETVIGKHLIAYNGMIKKLELDKRGDDTSFVTKVAEEIFSDK
A0A3B3SG34_MCL1-01      ALSTLKRVVATVVEKHKFAYNGMIGKLSLNQQSDDMTVIKTVAERIFSDG
                        * ..*.**. **: ** :****** **.*::..** :.:..*** **** 

A0A3B3R4U0_MCL1-01      VTNWGRIASLIAFGGVVCKYLKDHGQTNCVDDVASRISCYLLEHQRDWLN
A0A3B3SG34_MCL1-01      TTNWGRIASLVAFGAEVCKYLKETGREHCVEAVGKQISSYLLSEQRQWLL
                        .*********:***. ******: *. :**: *...**.***. **:** 

A0A3B3R4U0_MCL1-01      RNNGWEGFTDFFYMEDPESTV-RNALVAFAGVASLG-AGLALLMR
A0A3B3SG34_MCL1-01      KNKAWDGFVEFFHVEDTESLVLQKVLVHVSECGSFELHDLKALCM
                        .*:.*:**.:**::**.** * .:.** .:  .*:   .*  *  

© 1998-2019