Dataset for protein BCL-2-like of organism Paramormyrops kingsleyae

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3QRZ2_BCL2L1-      ----MSYSNRELVMDFITYKLSQRNYNGHFGL------------------
A0A3B3TCS4_BCL2-01      MANDVPYDSRNIVEIYIYHKLLKTGYVWEFQA------------------
A0A3B3TFR4_BCL2L1-      ----MSYSNRELVEYFVSYKLAQKNYSIAHII------------------
A0A3B3R4U0_MCL1-01      MNLINRTTATGL-----FCPGIKNGVKQNGFYSFV-----SASLPVAPLK
A0A3B3SG34_MCL1-01      MNPQSLKSYAPIMVSMNYHRPLHHGVLGKSILQCLDSSARAANTPCLESS
                                   :          : .                         

A0A3B3QRZ2_BCL2L1-      ----------PEDRGRTEGSGQADGREGVMVTATHVNGSVIAGGTSSQVS
A0A3B3TCS4_BCL2-01      ----------AGDTDSPNNGSVDSPPGSQ----VLARRSQAAAAGGEDAS
A0A3B3TFR4_BCL2L1-      ----------QDEADEQTGGGEGEAAGAV----AHANGSVSSGNSVGQGA
A0A3B3R4U0_MCL1-01      AKSEEELDS-LDEGERFHGAPKTERRDCE----H------HLRASGNEDG
A0A3B3SG34_MCL1-01      GLWDDELDNCTDEVDVCPCSTRLAKRDSE----KEPCRGSRLPGSTNAVG
                                    :      .                             .

A0A3B3QRZ2_BCL2L1-      PVPEQP-----------------------------------LHSPSPSPQ
A0A3B3TCS4_BCL2-01      -----P-----------------------------------VRSRTPRFD
A0A3B3TFR4_BCL2L1-      -----P-----------------------------------LEGATPQ--
A0A3B3R4U0_MCL1-01      SLPSTP-GTPPDCGKMLTFPNRG---LSQETHELIGTFLRTYSGLPAS-A
A0A3B3SG34_MCL1-01      SLPTSPDGDLPAYGPICGFSRSAVEMLDQETSELITTFFAEYTGLCATLQ
                             *                                     .  .   

A0A3B3QRZ2_BCL2L1-      GLEAVKEALRDSANEFELRYSRAFSDLSSQLHITPVTAYQSF-ESVMNEV
A0A3B3TCS4_BCL2-01      PHARLHRVLREAGDEIERMFQRDFSEMHEELHITPSTAQRRF-TAVIEEL
A0A3B3TFR4_BCL2L1-      GLEAVKEALRLSANEFEFRYQRAFSDLSSQLHITPATAYQSF-ESVMNEV
A0A3B3R4U0_MCL1-01      SRHKAYPVLRRVAETVIGKHLIAYNGMIKKLELDKRGDDTSFVTKVAEEI
A0A3B3SG34_MCL1-01      RRNEALSTLKRVVATVVEKHKFAYNGMIGKLSLNQQSDDMTVIKTVAERI
                               .*.     .   .   :. :  :* :        .   * : :

A0A3B3QRZ2_BCL2L1-      FRDGI-NWGRIVGLFAFGGALCVECVEKEMGHLVDRIADWMTVYLDSNIQ
A0A3B3TCS4_BCL2-01      FSDGV-NWGRIVAFLEFGGTMCVESVNREMTSQVDNIAHWMTEYLNGPLH
A0A3B3TFR4_BCL2L1-      FRDGV-NWGRVVGLFAFGGALCVECVEKEMSPLVGHIVDWMTVYLDNHIQ
A0A3B3R4U0_MCL1-01      FSDKVTNWGRIASLIAFGGVVCKYLKDHGQTNCVDDVASRISCYLLEHQR
A0A3B3SG34_MCL1-01      FSDGTTNWGRIASLVAFGAEVCKYLKETGREHCVEAVGKQISSYLLSEQR
                        * *   ****:..:. **. :*    :      *  :  .:: **    .

A0A3B3QRZ2_BCL2L1-      PWIQRQGGWDRFAEIFGKDAAAESRRSQENFKKWLLAGMTLITGVVVGSL
A0A3B3TCS4_BCL2-01      NWIQENGGWDAFVEIYGQQRGS----VMACFWPYLKTVFGLAALGAVGVT
A0A3B3TFR4_BCL2L1-      PWIQTQGGWDRFAEIFGNDAAAEGRRSRERFQQWLPAAMALVAGALVGFL
A0A3B3R4U0_MCL1-01      DWLNRNNGWEGFTDFFYMEDPESTV-RNALVAFAGVASLG-AGLALLMR-
A0A3B3SG34_MCL1-01      QWLLKNKAWDGFVEFFHVEDTESLVLQKVLVHVSECGSFELHDLKALCM-
                         *:  : .*: *.:::  :           .       :       :   

A0A3B3QRZ2_BCL2L1-      IAQ--KRL
A0A3B3TCS4_BCL2-01      ISAYFTKK
A0A3B3TFR4_BCL2L1-      IAK--KRQ
A0A3B3R4U0_MCL1-01      --------
A0A3B3SG34_MCL1-01      --------
                                

© 1998-2019