Dataset for protein Bcl-xL of organism Paramormyrops kingsleyae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3QRZ2_BCL2L1-      MSYSNRELVMDFITYKLSQRNYNGHFGLPEDRGRTEGSGQADGREGVMVT
A0A3B3TFR4_BCL2L1-      MSYSNRELVEYFVSYKLAQKNYSIAHIIQDEADEQTGGGEGEAAGAV---
                        *********  *::***:*.**.  . : :: .   *.*:.:.  .*   

A0A3B3QRZ2_BCL2L1-      ATHVNGSVIAGGTSSQVSPVPEQPLHSPSPSPQGLEAVKEALRDSANEFE
A0A3B3TFR4_BCL2L1-      -AHANGSVSSGNSVGQGAPL-------EGATPQGLEAVKEALRLSANEFE
                         :*.**** :*.: .* :*:        ..:************ ******

A0A3B3QRZ2_BCL2L1-      LRYSRAFSDLSSQLHITPVTAYQSFESVMNEVFRDGINWGRIVGLFAFGG
A0A3B3TFR4_BCL2L1-      FRYQRAFSDLSSQLHITPATAYQSFESVMNEVFRDGVNWGRVVGLFAFGG
                        :**.**************.*****************:****:********

A0A3B3QRZ2_BCL2L1-      ALCVECVEKEMGHLVDRIADWMTVYLDSNIQPWIQRQGGWDRFAEIFGKD
A0A3B3TFR4_BCL2L1-      ALCVECVEKEMSPLVGHIVDWMTVYLDNHIQPWIQTQGGWDRFAEIFGND
                        ***********. **..*.********.:****** ************:*

A0A3B3QRZ2_BCL2L1-      AAAESRRSQENFKKWLLAGMTLITGVVVGSLIAQKRL
A0A3B3TFR4_BCL2L1-      AAAEGRRSRERFQQWLPAAMALVAGALVGFLIAKKRQ
                        ****.***.*.*::** *.*:*::*.:** ***:** 

© 1998-2019