Dataset for protein BCL-2-like of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096MPU7_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A096NM44_BCL2L10      ----------------------MADPLRERTER--LLADYL---------
A0A096NMX5_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A096NMX5_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A2I3M3D6_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT------------
A0A2I3M3D6_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2I3M3D6_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2I3MUE4_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2I3MUE4_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
                                                           :              

A0A096MPU7_BCL2-01      EWDAGDGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTP----
A0A096NM44_BCL2L10      -----------------GCCAREPG---------------TPEPRP----
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2I3M3D6_MCL1-02      GEAGTVIGGTAGASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFA
A0A2I3M3D6_MCL1-01      GEAGTVIGGTAGASPPAALTPDARRVARPPPIGAEVPDVTATPARPLFFA
A0A2I3MUE4_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A2I3MUE4_BCL2L2-      -QKGYVCGAGPG--------------------------------------
                                                                          

A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2I3M3D6_MCL1-02      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2I3M3D6_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2I3MUE4_BCL2L2-      -----------EGPAADPL-------------------------------
A0A2I3MUE4_BCL2L2-      -----------EGPAADPL-------------------------------
                                                                          

A0A096MPU7_BCL2-01      -----------------------------------------AAPAAAAGP
A0A096NM44_BCL2L10      -----------------------------------------STPEAA---
A0A096NMX5_BCL2A1-      ------------------------------------------------IP
A0A096NMX5_BCL2A1-      ------------------------------------------------IP
A0A2I3M3D6_MCL1-03      -----------------------------------------GAKDTKPMG
A0A2I3M3D6_MCL1-02      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMG
A0A2I3M3D6_MCL1-01      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISWYLREQATGAKDTKPMG
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
                                                                          

A0A096MPU7_BCL2-01      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
A0A096NM44_BCL2L10      ----VLRSAAARLRQLHRSFFSAYR---GYPGNRVELVALMAEAV-LSD-
A0A096NMX5_BCL2A1-      QPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQV
A0A096NMX5_BCL2A1-      QPGLGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQV
A0A2I3M3D6_MCL1-03      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A2I3M3D6_MCL1-02      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A2I3M3D6_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
A0A2I3MUE4_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
A0A2I3MUE4_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
                                    :.     .              :               

A0A096MPU7_BCL2-01      VEELFRDGV-NWGRIVAFFEFGGVMC------------------VESVNR
A0A096NM44_BCL2L10      -----SPGP-TWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEG
A0A096NMX5_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQ
A0A096NMX5_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILI------------------KKLLRQ
A0A2I3M3D6_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVA------------------KHLKTI
A0A2I3M3D6_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVA------------------KHLKTI
A0A2I3M3D6_MCL1-01      ---LPCRGPRRW--------------------------------------
A0A2I3MUE4_BCL2L2-      SDELFQGGP-NWGRLVAFFVFGAALC------------------AESVNK
A0A2I3MUE4_BCL2L2-      SDELFQGGP-NWGRLVAFFVFGAALC------------------AESVNK
                               *   *                                      

A0A096MPU7_BCL2-01      EMSPLVDNIAL---WMTEYLNRHLHTWIQDNGGWDAFVELYG------PS
A0A096NM44_BCL2L10      DVARDCQRLVA---LLSSRLAGQHRAWLQAQGGWVSTRRTPGRGAGRASG
A0A096NMX5_BCL2A1-      RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------------
A0A096NMX5_BCL2A1-      RIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKF-EP-----
A0A2I3M3D6_MCL1-03      NQESCIEPLAE---SITDVLVRTKRDWLVKQRGWDGFVEFFH-VEDLEGG
A0A2I3M3D6_MCL1-02      NQESCIEPLAE---SITDVLVRTKRDWLVKQRGWDGFVEFFH-VEDLEGG
A0A2I3M3D6_MCL1-01      -HQKCAAGFCR---CCWS------RSWF----------------------
A0A2I3MUE4_BCL2L2-      EMEPLVGQVQE---WMVAYLETRLADWIHSSGGWA-EFTALY-GDGALEE
A0A2I3MUE4_BCL2L2-      EMEPLVGQVQE---WMVAYLETRLADWIHSSGGWELEAIKAR-VREMEEE
                                                  *:                      

A0A096MPU7_BCL2-01      MRPLFDFSWL----------------------------SLKTLLSLALVG
A0A096NM44_BCL2L10      KRPRGRHGWLLSLLQEPLSAGFLEKTADPGFPGMLVSNSLRLSLDTIIMS
A0A096NMX5_BCL2A1-      ------------------------------------------WHNHMPM-
A0A096NMX5_BCL2A1-      ---------------------------------------KSGWMTFLEVT
A0A2I3M3D6_MCL1-03      IRNV-----------------------------------LLAFAGVAGVG
A0A2I3M3D6_MCL1-02      IRNV-----------------------------------LLAFAGVAGVG
A0A2I3M3D6_MCL1-01      -----------------------------------------------GIS
A0A2I3MUE4_BCL2L2-      ARRLRE---------------GNWASV------------RTVLTGAVALG
A0A2I3MUE4_BCL2L2-      AEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYG
                                                                          

A0A096MPU7_BCL2-01      ACITLGAYLGHK--------------------------------------
A0A096NM44_BCL2L10      FNIFNPLLPAQL--------------------------------------
A0A096NMX5_BCL2A1-      --LVESVAHKKKKMAL----------------------------------
A0A096NMX5_BCL2A1-      GKICEMLSLLKQYC------------------------------------
A0A2I3M3D6_MCL1-03      AGLAYLIR------------------------------------------
A0A2I3M3D6_MCL1-02      AGLAYLIR------------------------------------------
A0A2I3M3D6_MCL1-01      NKIALL--------------------------------------------
A0A2I3MUE4_BCL2L2-      ALVT----------------------------------------------
A0A2I3MUE4_BCL2L2-      ATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLAL
                                                                          

A0A096MPU7_BCL2-01      --------------------------------------------------
A0A096NM44_BCL2L10      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A096NMX5_BCL2A1-      --------------------------------------------------
A0A2I3M3D6_MCL1-03      --------------------------------------------------
A0A2I3M3D6_MCL1-02      --------------------------------------------------
A0A2I3M3D6_MCL1-01      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      --------------------------------------------------
A0A2I3MUE4_BCL2L2-      DESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYS
                                                                          

A0A096MPU7_BCL2-01      ------------------------
A0A096NM44_BCL2L10      ------------------------
A0A096NMX5_BCL2A1-      ------------------------
A0A096NMX5_BCL2A1-      ------------------------
A0A2I3M3D6_MCL1-03      ------------------------
A0A2I3M3D6_MCL1-02      ------------------------
A0A2I3M3D6_MCL1-01      ------------------------
A0A2I3MUE4_BCL2L2-      ----------------VGAFFASK
A0A2I3MUE4_BCL2L2-      GFNSRPRGRVYRGRARATSWYSPY
                                                

© 1998-2019