Dataset for protein Mcl-1 of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K7DE58_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
K7DE58_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
K7DE58_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL------------------------
G2HFR3_MCL1-01      ------------------------------------------------------------
K7DE58_MCL1-04      ------------------------------------------------------------
                                                                                

K7DE58_MCL1-02      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
K7DE58_MCL1-01      AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
K7DE58_MCL1-03      ------------------------------------------------------------
G2HFR3_MCL1-01      ------------------------------------------------------------
K7DE58_MCL1-04      ------------------------------------------------------------
                                                                                

K7DE58_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
K7DE58_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
K7DE58_MCL1-03      ------------------------------------------------------------
G2HFR3_MCL1-01      ------------------------------------------------------------
K7DE58_MCL1-04      ------------------------------------------------------------
                                                                                

K7DE58_MCL1-02      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV-----
K7DE58_MCL1-01      IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
K7DE58_MCL1-03      ---------ATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
G2HFR3_MCL1-01      -----------------------MDICRLSAAMREFYIVHLDIYPPPECTIHMLLDIKNE
K7DE58_MCL1-04      ---------------------------------------------SVETCMLRKLDIKNE
                                                                 .        :     

K7DE58_MCL1-02      ------------LPCRGPRRW---------------------HQECAAGFCRCCWS----
K7DE58_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
K7DE58_MCL1-03      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
G2HFR3_MCL1-01      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
K7DE58_MCL1-04      DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                                : . *  .*                     ::.*   :. .  .    

K7DE58_MCL1-02      --RSWF---------------------------------GISNKIALL--
K7DE58_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
K7DE58_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
G2HFR3_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
K7DE58_MCL1-04      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                      *.*:                                 *:.  :* *  

© 1998-2019