Dataset for protein Mcl-1 of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3RTV4_MCL1-01      ------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASA
A0A2I3RTV4_MCL1-03      ------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------
G2HFR3_MCL1-01          MDICRLSAAMREFYIVHLDIY-------------PPPECTIH--------
                                .:.   :: *::*             .**   :         

A0A2I3RTV4_MCL1-01      RREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPA
A0A2I3RTV4_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
                                                                          

A0A2I3RTV4_MCL1-01      RLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLL
A0A2I3RTV4_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
                                                                          

A0A2I3RTV4_MCL1-01      ELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAK
A0A2I3RTV4_MCL1-03      ---------------------------------------------ATGAK
G2HFR3_MCL1-01          ---------------------------------------------ML---
                                                                          

A0A2I3RTV4_MCL1-01      DTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
A0A2I3RTV4_MCL1-03      DTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVK
G2HFR3_MCL1-01          ----------------------------------------LDIKNEDDVK
                                                                **********

A0A2I3RTV4_MCL1-01      SLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESI
A0A2I3RTV4_MCL1-03      SLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESI
G2HFR3_MCL1-01          SLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESI
                        **************************************************

A0A2I3RTV4_MCL1-01      TDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAG
A0A2I3RTV4_MCL1-03      TDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAG
G2HFR3_MCL1-01          TDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAG
                        **************************************************

A0A2I3RTV4_MCL1-01      LAYLIR
A0A2I3RTV4_MCL1-03      LAYLIR
G2HFR3_MCL1-01          LAYLIR
                        ******

© 1998-2019