Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       -------------MVDQWRERTTMADPLRERTERLLADYLGYCAREP---
H2Q805_BCL2L2-01        ----------------------MATPASAPDTRALVADFVGYKLRQKGYV
A0A2I3T6T8_BCL2A1-      -----------------------MTDCEFGYIYRLAQDYLQYVLQI----
A0A2I3T6T8_BCL2A1-      -----------------------MTDCEFGYIYRLAQDYLQYVLQI----
A0A2I3T6T8_BCL2A1-      -----------------------MTDCEFGYIYRLAQDYLQYVLQI----
K7DE58_MCL1-03          MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPM----
G2HFR3_MCL1-01          --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRG--
H2Q805_BCL2L2-02        ----------------------MATPASAPDTRALVADFVGYKLRQKG--
K7DE58_MCL1-02          ----------------------------------------MFGLKRNAVI
K7DE58_MCL1-01          ----------------------------------------MFGLKRNAVI
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       ------------GTPEPTPSTPEA--------------------------
H2Q805_BCL2L2-01        CGA--------GPGEGPAADPLHQ--------------------------
A0A2I3T6T8_BCL2A1-      ------------PQPGSGPSKTSR--------------------------
A0A2I3T6T8_BCL2A1-      ------------PQPGSGPSKTSR--------------------------
A0A2I3T6T8_BCL2A1-      ------------PQPGSGPSKTSR--------------------------
K7DE58_MCL1-03          ------------GRSGATSRKALE--------------------------
G2HFR3_MCL1-01          ----------------MDICRLSA--------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          ----YEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQ
H2Q805_BCL2L2-02        ----YVCGAG-PGEGP-AADPLHQ--------------------------
K7DE58_MCL1-02          GLNLYCGGAG-LGAGSGGATPPGG--------------------------
K7DE58_MCL1-01          GLNLYCGGAG-LGAGSGGATPPGG--------------------------
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       ----------------------AVLRSAAARLRQIHRSFFSAYLGYPGNR
H2Q805_BCL2L2-01        ----------------------AMRAAGDEFETRFRRTFSDLAAQLHVTP
A0A2I3T6T8_BCL2A1-      ----------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVS
A0A2I3T6T8_BCL2A1-      ----------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVS
A0A2I3T6T8_BCL2A1-      ----------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVS
K7DE58_MCL1-03          ----------------------TLRRVGDGVQRNHETAFQGMLRKLDIKN
G2HFR3_MCL1-01          ----------------------AMREFYIVHLDIYPPPECTIHMLLDIKN
K7DE58_MCL1-04          ------------------------------------SVETCMLRKLDIKN
H2QEM8_BCL2-01          TPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP
H2Q805_BCL2L2-02        ----------------------AMRAAGDEFETRFRRTFSDLAAQLHVTP
K7DE58_MCL1-02          ----------------------RLLATEKEASARREIGGGEAGAVIGGSA
K7DE58_MCL1-01          ----------------------RLLATEKEASARREIGGGEAGAVIGGSA
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       FELVALMADSVLSDSPG---PTWGRVVTLVTFAGTLLERGPLVTTRWKKW
H2Q805_BCL2L2-01        GSAQQRF-TQVSDELFQGG-PNWGRLVAFFVFGAALCAE-----------
A0A2I3T6T8_BCL2A1-      VDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK-----------
A0A2I3T6T8_BCL2A1-      VDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK-----------
A0A2I3T6T8_BCL2A1-      VDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKK-----------
K7DE58_MCL1-03          EDDVKSL-SRVMIHVFSDGVTNWGRIVTLISFGAFVAKH-----------
G2HFR3_MCL1-01          EDDVKSL-SRVMIHVFSDGVTNWGRIVTLISFGAFVAKH-----------
K7DE58_MCL1-04          EDDVKSL-SRVMIHVFSDGVTNWGRIVTLISFGAFVAKH-----------
H2QEM8_BCL2-01          FTARGRF-ATVVEELFRDG-VNWGRIVAFFEFGGVMCVE-----------
H2Q805_BCL2L2-02        GSAQQRF-TQVSDELFQGG-PNWGRLVAFFVFGAALCAE-----------
K7DE58_MCL1-02          GASPPST-LTPDSRRVARP-PPIGAEV-----------------------
K7DE58_MCL1-01          GASPPST-LTPDSRRVARP-PPIGAEV-----------------------
                                                                          

A0A2I3T6T8_BCL2A1-      ------------------------------VARSWLTAASTSTAQEN---
H2Q9G4_BCL2L10-01       GFQPRLNEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWD-------
H2Q805_BCL2L2-01        ----SVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWA-------
A0A2I3T6T8_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK------
A0A2I3T6T8_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------
A0A2I3T6T8_BCL2A1-      ----LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------
K7DE58_MCL1-03          ----L---KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-------
G2HFR3_MCL1-01          ----L---KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-------
K7DE58_MCL1-04          ----L---KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-------
H2QEM8_BCL2-01          ----SVNREMSP---LVDNIALWMTEYLNRHLHTWIQDNGGWDA------
H2Q805_BCL2L2-02        ----SVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWELEAIKAR
K7DE58_MCL1-02          -----------P---DVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSP
K7DE58_MCL1-01          -----------P---DVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSP
                                                           :              

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          --------------------FVELYGPS----------------------
H2Q805_BCL2L2-02        VREMEEEAEK----------LKELQNEVEKQMNMSPPPGNAGPVIMSIEE
K7DE58_MCL1-02          EEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEED
K7DE58_MCL1-01          EEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEED
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          -----------------------MRPLFDFSWLSLKTLLSLALVG-----
H2Q805_BCL2L2-02        KMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF
K7DE58_MCL1-02          ELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG-----
K7DE58_MCL1-01          ELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG-----
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          --------ACITLG------AYLGHK------------------------
H2Q805_BCL2L2-02        AYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDR
K7DE58_MCL1-02          --------DGVQRN---HETAFQGWVCGV-----------------LPCR
K7DE58_MCL1-01          --------DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSD
                                                                          

A0A2I3T6T8_BCL2A1-      --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      --------------------------------------------------
K7DE58_MCL1-03          --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
K7DE58_MCL1-04          --------------------------------------------------
H2QEM8_BCL2-01          --------------------------------------------------
H2Q805_BCL2L2-02        GFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWY
K7DE58_MCL1-02          GPRRW---------------------HQECAAGFCRCCWS------RSWF
K7DE58_MCL1-01          GVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWL
                                                                          

A0A2I3T6T8_BCL2A1-      -------GFVKKFEH-------KSGWMTFLEVTGKISILLTRKDTPYCET
H2Q9G4_BCL2L10-01       -------GFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL---
H2Q805_BCL2L2-01        -------EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
A0A2I3T6T8_BCL2A1-      -WHNHTPMLVESVAH-------KKRKMAL---------------------
A0A2I3T6T8_BCL2A1-      -------GFVKKFEH-------KSGWMTFLEVTGKISILLTRKDTPYCET
A0A2I3T6T8_BCL2A1-      -------GFVKKFEH-------KSGWMTFLEVTGKICEMLSLLKQ-YC--
K7DE58_MCL1-03          -------GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------
G2HFR3_MCL1-01          -------GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------
K7DE58_MCL1-04          -------GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------
H2QEM8_BCL2-01          --------------------------------------------------
H2Q805_BCL2L2-02        SPY-----------------------------------------------
K7DE58_MCL1-02          ---------------------------------GISNKIALL--------
K7DE58_MCL1-01          VKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------
                                                                          

A0A2I3T6T8_BCL2A1-      GLIFLTVMETIANTYFYF
H2Q9G4_BCL2L10-01       ------------------
H2Q805_BCL2L2-01        FFASK-------------
A0A2I3T6T8_BCL2A1-      ------------------
A0A2I3T6T8_BCL2A1-      GLIFLTVMETIANTYFYF
A0A2I3T6T8_BCL2A1-      ------------------
K7DE58_MCL1-03          ------------------
G2HFR3_MCL1-01          ------------------
K7DE58_MCL1-04          ------------------
H2QEM8_BCL2-01          ------------------
H2Q805_BCL2L2-02        ------------------
K7DE58_MCL1-02          ------------------
K7DE58_MCL1-01          ------------------
                                          

© 1998-2019