Dataset for protein BCL-2-like of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2QEM8_BCL2-01          ---------------------------------MAHAGRTGYDNREIVMK
H2Q9G4_BCL2L10-01       MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTPSTPEAAVL-
A0A2I3RTV4_MCL1-03      -----------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATG
G2HFR3_MCL1-01          -----MDICRLSAAMREFYIVHLDIY-------------PPPECTIHML-
A0A2I3RTV4_MCL1-01      -----------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATE
H2Q805_BCL2L2-01        ----------------------------------MATPASAPDTRALVAD
H2Q805_BCL2L2-02        ----------------------------------MATPASAPDTRALVAD
                                                               .          

H2QEM8_BCL2-01          YIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVA
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      AKDTKPM-------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A2I3RTV4_MCL1-01      KEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDV
H2Q805_BCL2L2-01        FVGYKLR-----QKGYVCGAGPG---------------------------
H2Q805_BCL2L2-02        FVGYKLR-----QKGYVCGAGPG---------------------------
                                                                          

H2QEM8_BCL2-01          RTSPLQTPAAPGAA--------AGPALSPV--------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A2I3RTV4_MCL1-01      TATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPA
H2Q805_BCL2L2-01        ----------------------EGPAADPL--------------------
H2Q805_BCL2L2-02        ----------------------EGPAADPL--------------------
                                                                          

H2QEM8_BCL2-01          --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A2I3RTV4_MCL1-01      VLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQ
H2Q805_BCL2L2-01        --------------------------------------------------
H2Q805_BCL2L2-02        --------------------------------------------------
                                                                          

H2QEM8_BCL2-01          ----------------PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP
H2Q9G4_BCL2L10-01       ------------------------RSAAARLRQIHRSFFSAYLGYPGNRF
A0A2I3RTV4_MCL1-03      ----------GRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
G2HFR3_MCL1-01          ---------------------------------------------LDIKN
A0A2I3RTV4_MCL1-01      ATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
H2Q805_BCL2L2-01        --------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP
H2Q805_BCL2L2-02        --------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP
                                                                          

H2QEM8_BCL2-01          FTARGRFATVVEELFRDG-------VNWGRIVAFFEF-------GGVMCV
H2Q9G4_BCL2L10-01       E---------LVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTT
A0A2I3RTV4_MCL1-03      EDDVKSLSRVMIHVFSDGV------TNWGRIVTLISF-------GAFVAK
G2HFR3_MCL1-01          EDDVKSLSRVMIHVFSDGV------TNWGRIVTLISF-------GAFVAK
A0A2I3RTV4_MCL1-01      EDDVKSLSRVMIHVFSDGV------TNWGRIVTLISF-------GAFVAK
H2Q805_BCL2L2-01        GSAQQRFTQVSDELFQGG-------PNWGRLVAFFVF-------GAALCA
H2Q805_BCL2L2-02        GSAQQRFTQVSDELFQGG-------PNWGRLVAFFVF-------GAALCA
                                     :: ..        .***:*::. *       *  :  

H2QEM8_BCL2-01          ESVNREMSPLV-----------DNIALWMTEYLNRHLHTWIQDNGGWD-A
H2Q9G4_BCL2L10-01       RWKKWGFQPRLNEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWD-G
A0A2I3RTV4_MCL1-03      HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD-G
G2HFR3_MCL1-01          HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD-G
A0A2I3RTV4_MCL1-01      HLKTINQESCI-----------EPLAESITDVLVRTKRDWLVKQRGWD-G
H2Q805_BCL2L2-01        ESVNKEMEPLV-----------GQVQEWMVAYLETRLADWIHSSGGWA-E
H2Q805_BCL2L2-02        ESVNKEMEPLV-----------GQVQEWMVAYLETRLADWIHSSGGWELE
                           .   .. :             :   :   *      *:  . **   

H2QEM8_BCL2-01          FVELYG---------------------------PSMRPL-----FDFSWL
H2Q9G4_BCL2L10-01       FCHFFRTPFPL----------------------AFWRKQ-----------
A0A2I3RTV4_MCL1-03      FVEFFHVEDLE----------------------GGIRNV-----------
G2HFR3_MCL1-01          FVEFFHVEDLE----------------------GGIRNV-----------
A0A2I3RTV4_MCL1-01      FVEFFHVEDLE----------------------GGIRNV-----------
H2Q805_BCL2L2-01        FTALYGDGALEEARRLRE---------------GNWASV-----------
H2Q805_BCL2L2-02        AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
                                                                          

H2QEM8_BCL2-01          SLKTLLSLALVGACIT----------------------------------
H2Q9G4_BCL2L10-01       -LVQAFLSCLLTTAFI----------------------------------
A0A2I3RTV4_MCL1-03      -LLAFAGVAGVGAGLA----------------------------------
G2HFR3_MCL1-01          -LLAFAGVAGVGAGLA----------------------------------
A0A2I3RTV4_MCL1-01      -LLAFAGVAGVGAGLA----------------------------------
H2Q805_BCL2L2-01        -RTVLTGAVALGALVT----------------------------------
H2Q805_BCL2L2-02        ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEF
                                    :                                     

H2QEM8_BCL2-01          --------------------------------------------------
H2Q9G4_BCL2L10-01       --------------------------------------------------
A0A2I3RTV4_MCL1-03      --------------------------------------------------
G2HFR3_MCL1-01          --------------------------------------------------
A0A2I3RTV4_MCL1-01      --------------------------------------------------
H2Q805_BCL2L2-01        --------------------------------------------------
H2Q805_BCL2L2-02        SDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
                                                                          

H2QEM8_BCL2-01          ----------------------------LGAYLGHK---
H2Q9G4_BCL2L10-01       --------------------------------YLWTRLL
A0A2I3RTV4_MCL1-03      --------------------------------YLIR---
G2HFR3_MCL1-01          --------------------------------YLIR---
A0A2I3RTV4_MCL1-01      --------------------------------YLIR---
H2Q805_BCL2L2-01        ----------------------------VGAFFASK---
H2Q805_BCL2L2-02        TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY---
                                                               

© 1998-2019