Dataset for protein Bfl1 of organism Pan troglodytes

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3T6T8_BCL2A1-      --------------------------------------------------
A0A2I3T6T8_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
A0A2I3T6T8_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
A0A2I3T6T8_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
                                                                          

A0A2I3T6T8_BCL2A1-      ---------------VARSWLTAASTSTAQEN------------------
A0A2I3T6T8_BCL2A1-      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I3T6T8_BCL2A1-      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
A0A2I3T6T8_BCL2A1-      NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI
                                       .**: :. .  .  ::.                  

A0A2I3T6T8_BCL2A1-      ------------------------------------------------GF
A0A2I3T6T8_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPML
A0A2I3T6T8_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------GF
A0A2I3T6T8_BCL2A1-      KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------GF
                                                                         :

A0A2I3T6T8_BCL2A1-      VKKFEHKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYF
A0A2I3T6T8_BCL2A1-      VESVAHKKRKMAL-------------------------------------
A0A2I3T6T8_BCL2A1-      VKKFEHKSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTVMETIANTYF
A0A2I3T6T8_BCL2A1-      VKKFEHKSGWMTFLEVTGKICEMLSLLKQ-YC------------------
                        *:.. **. .*::                                     

A0A2I3T6T8_BCL2A1-      YF
A0A2I3T6T8_BCL2A1-      --
A0A2I3T6T8_BCL2A1-      YF
A0A2I3T6T8_BCL2A1-      --
                          

© 1998-2019