Dataset for protein BCL-2-like of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R9A7B2_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP-AADPLH
A0A2R9BYH6_MCL1-02      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
A0A2R9BYH6_MCL1-01      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
A0A2R9BCD9_BCL2L10      -------------MVDQWRERTTMADPLRERTE-----------------
A0A2R9A7B2_BCL2L2-      -------------MATPASAPDTRALVADFVGY-----------------
A0A2R9APW6_BCL2-01      -------------MAHAGRTGYDNREIVMKYIHY----------------
A0A2R9BYH6_MCL1-03      ------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG
A0A2R8ZJX9_BCL2A1-      --------------MTDCEFGY---------IY-----------------
A0A2R8ZJX9_BCL2A1-      --------------MTDCEFGY---------IY-----------------
A0A2R8ZJX9_BCL2A1-      --------------MTDCEFGY---------IY-----------------
                                                                          

A0A2R9A7B2_BCL2L2-      QAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNW
A0A2R9BYH6_MCL1-02      GRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPI
A0A2R9BYH6_MCL1-01      GRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPI
A0A2R9BCD9_BCL2L10      -RLL----------------------------------------------
A0A2R9A7B2_BCL2L2-      -KLR----------------------------------------------
A0A2R9APW6_BCL2-01      -KLS----------------------------------------------
A0A2R9BYH6_MCL1-03      GRLL----------------------------------------------
A0A2R8ZJX9_BCL2A1-      -RLA----------------------------------------------
A0A2R8ZJX9_BCL2A1-      -RLA----------------------------------------------
A0A2R8ZJX9_BCL2A1-      -RLA----------------------------------------------
                          :                                               

A0A2R9A7B2_BCL2L2-      GRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGG
A0A2R9BYH6_MCL1-02      GAEV-------------------PDVTATPARLLFFAPTRRAAPLEEMEA
A0A2R9BYH6_MCL1-01      GAEV-------------------PDVTATPARLLFFAPTRRAAPLEEMEA
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
                                                                          

A0A2R9A7B2_BCL2L2-      WELEAIKARVREMEEEAEK----------LKELQNEVEKQMNMSPPPGNA
A0A2R9BYH6_MCL1-02      PAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPST
A0A2R9BYH6_MCL1-01      PAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPST
A0A2R9BCD9_BCL2L10      --------------------------------------------------
A0A2R9A7B2_BCL2L2-      --------------------------------------------------
A0A2R9APW6_BCL2-01      --------------------------------------------------
A0A2R9BYH6_MCL1-03      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
A0A2R8ZJX9_BCL2A1-      --------------------------------------------------
                                                                          

A0A2R9A7B2_BCL2L2-      GPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTIL--
A0A2R9BYH6_MCL1-02      PPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALE--
A0A2R9BYH6_MCL1-01      PPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALE--
A0A2R9BCD9_BCL2L10      --------------------------ADYLGYCAREPGTPEPTPSTPE--
A0A2R9A7B2_BCL2L2-      --------------------------QKGYVC---GAGPGEGPAADPL--
A0A2R9APW6_BCL2-01      --------------------------QRGYEW--DAGDVGAAPLSPVPPV
A0A2R9BYH6_MCL1-03      --------------------------ATGAKDTKPMGRSGATSRKALE--
A0A2R8ZJX9_BCL2A1-      --------------------------QDYLQYVLQIPQPGSGPSQTSR--
A0A2R8ZJX9_BCL2A1-      --------------------------QDYLQYVLQIPQPGSGPSQTSR--
A0A2R8ZJX9_BCL2A1-      --------------------------QDYLQYVLQIPQPGSGPSQTSR--
                                                                          

A0A2R9A7B2_BCL2L2-      ---CDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV------I
A0A2R9BYH6_MCL1-02      ---TLRRVG-------------DGVQRN---HETAFQGWVCGV-------
A0A2R9BYH6_MCL1-01      ---TLRRVG-------------DGVQRN---HETAFQGMLRKLDIKNEDD
A0A2R9BCD9_BCL2L10      -AAVLRSAA-------------ARLRQI---HRSFFSAYLGYPG-----N
A0A2R9A7B2_BCL2L2-      -HQAMRAAG-------------DEFETR---FRRTFSDLAAQLHVTPG-S
A0A2R9APW6_BCL2-01      VHLTLRQAG-------------DDFSRR---YRRDFAEMSSQLHLTPF-T
A0A2R9BYH6_MCL1-03      ---TLRRVG-------------DGVQRN---HETAFQGMLRKLDIKNEDD
A0A2R8ZJX9_BCL2A1-      ---VLQNVA-------------FSVQKE---VEKNLKSCLDNVNVVSVDT
A0A2R8ZJX9_BCL2A1-      ---VLQNVA-------------FSVQKE---VEKNLKSCLDNVNVVSVDT
A0A2R8ZJX9_BCL2A1-      ---VLQNVA-------------FSVQKE---VEKNLKSCLDNVNVVSVDT
                             .  .               .          :              

A0A2R9A7B2_BCL2L2-      PKRT-NRPGISTTDRGF-PRARYRARTTNYNSSRSRF-------------
A0A2R9BYH6_MCL1-02      -----------LPCRGP-RRW-----------------------------
A0A2R9BYH6_MCL1-01      VKSL-SRVMIHVFSDGV-TNWGRIVTLISFGAFVAKH-------------
A0A2R9BCD9_BCL2L10      RFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTTRWKKWGF
A0A2R9A7B2_BCL2L2-      AQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCAE-------------
A0A2R9APW6_BCL2-01      ARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCVE-------------
A0A2R9BYH6_MCL1-03      VKSL-SRVMIHVFSDGV-TNWGRIVTLISFGAFVAKH-------------
A0A2R8ZJX9_BCL2A1-      ARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-------------
A0A2R8ZJX9_BCL2A1-      ARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-------------
A0A2R8ZJX9_BCL2A1-      ARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-------------
                                       .                                  

A0A2R9A7B2_BCL2L2-      -----YSGFNSRPRGRVYRGRARA------TSWYSPY-------------
A0A2R9BYH6_MCL1-02      ----------HQECAAGFCRCCWS------RSWF----------------
A0A2R9BYH6_MCL1-01      -----LKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-------GF
A0A2R9BCD9_BCL2L10      QPRLKEQEGDVARDCQRLVALLSSRLVGQHRAWLQAQGGWD-------GF
A0A2R9A7B2_BCL2L2-      --SVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSGGWA-------EF
A0A2R9APW6_BCL2-01      --SVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGWD-------AF
A0A2R9BYH6_MCL1-03      --L---KTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD-------GF
A0A2R8ZJX9_BCL2A1-      --LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGKWHNHTPML
A0A2R8ZJX9_BCL2A1-      --LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------GF
A0A2R8ZJX9_BCL2A1-      --LLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWEN------GF
                                                        *                 

A0A2R9A7B2_BCL2L2-      --------------------------------------------------
A0A2R9BYH6_MCL1-02      ------------------------GISNKIALL-----------------
A0A2R9BYH6_MCL1-01      VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR---------------
A0A2R9BCD9_BCL2L10      CHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL------------
A0A2R9A7B2_BCL2L2-      TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK----
A0A2R9APW6_BCL2-01      VELYGP-SMRPLFDFSWLSLKTL----LSLALVGACITLGAYLGHK----
A0A2R9BYH6_MCL1-03      VEFFHVEDLEGGIRNVLLAFAGV----AGVGAGLAYLIR-----------
A0A2R8ZJX9_BCL2A1-      VESVAH-------KKRKMAL------------------------------
A0A2R8ZJX9_BCL2A1-      VKKFEH-------KSGWMTFLEV----TGKICEMLSLLKQ-YC-------
A0A2R8ZJX9_BCL2A1-      VKKFEH-------KSGWMTFLEV----TGKISILLTRKDTPYCETGLIFL
                                                                          

A0A2R9A7B2_BCL2L2-      -------------
A0A2R9BYH6_MCL1-02      -------------
A0A2R9BYH6_MCL1-01      -------------
A0A2R9BCD9_BCL2L10      -------------
A0A2R9A7B2_BCL2L2-      -------------
A0A2R9APW6_BCL2-01      -------------
A0A2R9BYH6_MCL1-03      -------------
A0A2R8ZJX9_BCL2A1-      -------------
A0A2R8ZJX9_BCL2A1-      -------------
A0A2R8ZJX9_BCL2A1-      TVMETIANTYFYF
                                     

© 1998-2019