Dataset for protein BCL-2-like of organism Ovis aries

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5QDH5_BCL2L2-01       MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTR---------
W5Q0N6_BCL2A1-01       -------------------------------MTDTEFDYVH---------
W5QIG4_BCL2L10-01      ----------------------GRPPGRGGAMVDPFRERTA---------
W5QI41_MCL1-01         ---------------------GSRKPRPAPGPAPALTPPVRCRAQPPEAF
W5QDH5_BCL2L2-02       MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTR---------
Q9MZS7_BCL2L1-01       -----------------------------------MSQSNR---------
W5PSA5_BCL2L1-01       -----------------------------------MSQSNR---------
                                                                         

W5QDH5_BCL2L2-01       -------------ALVADFVGYKLRQKGY---------------------
W5Q0N6_BCL2A1-01       -------------KLAEDYLKYVLQI------------------------
W5QIG4_BCL2L10-01      -------------RLLMDWLEFC--A------------------------
W5QI41_MCL1-01         AAFPIYGMQIKRQQQWFKMFGFKRRPAVRPLPLMVGEASNNSPGSDGSLP
W5QDH5_BCL2L2-02       -------------ALVADFVGYKLRQKGY---------------------
Q9MZS7_BCL2L1-01       -------------ELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTES
W5PSA5_BCL2L1-01       -------------ELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTES
                                        . . :                            

W5QDH5_BCL2L2-01       -------------------------------------VCGAGPGEGPAAD
W5Q0N6_BCL2A1-01       ----------------------------------QQPGS----KPSKTSR
W5QIG4_BCL2L10-01      ----------------------------------REPGTPAPAPSTPEAA
W5QI41_MCL1-01         STPPPSEEEEDELYRQSLEIISQYLLEQATGTKDAKPLGGSGATSRKALE
W5QDH5_BCL2L2-02       -------------------------------------VCGAGPGEGPAAD
Q9MZS7_BCL2L1-01       DMETPSAINGNPSWHLA-----------------DSPAVNGATGHSRSLD
W5PSA5_BCL2L1-01       DMETPSAISGNPSWHLA-----------------DSPVVNGATGHSRSLD
                                                                         

W5QDH5_BCL2L2-01       P--------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQ
W5Q0N6_BCL2A1-01       V------------LQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQ
W5QIG4_BCL2L10-01      V------------LRHVAARVL-EANRNVLPLYRRYRRHRVELVARMAQR
W5QI41_MCL1-01         T------------LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSR
W5QDH5_BCL2L2-02       P--------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQ
Q9MZS7_BCL2L1-01       AREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQ
W5PSA5_BCL2L1-01       TGKMIPMAVVKQALREASNECELRYQQTFSDLTSQLHITPGKAYQS-FEQ
                                    :. ..          .     .              .

W5QDH5_BCL2L2-01       VSDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQ---------
W5Q0N6_BCL2A1-01       VMEKEFEDGIVNWGRIVTIFAFEGILTKK---LLSKRIASDMDMCKD---
W5QIG4_BCL2L10-01      LLD---EDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRL
W5QI41_MCL1-01         VMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP---------
W5QDH5_BCL2L2-02       VSDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQ---------
Q9MZS7_BCL2L1-01       VVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVSR---------
W5PSA5_BCL2L1-01       VINELFQDGV-NWGRNVAFFSFGGALCMKSIVKEMQVLVSQ---------
                       :      .   .*** .::. * . :                        

W5QDH5_BCL2L2-01       -VQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEV
W5Q0N6_BCL2A1-01       -ISYFVAEFITKNTGEWIRQNGGWE-------------------------
W5QIG4_BCL2L10-01      LVALLCAQFCERHRA-WLMANGGWD-------------------------
W5QI41_MCL1-01         -LAESITDVLVRSKRDWIVKQRGWD-------------------------
W5QDH5_BCL2L2-02       -VQEWMVAYLETRLADWIHSSGGWA-------------------------
Q9MZS7_BCL2L1-01       -IATWMATYLNDHLEPWIQENGGWD-------------------------
W5PSA5_BCL2L1-01       -VTTWMATYLNDHLEPWIQENGDWD-------------------------
                        :    .         *:  . .*                          

W5QDH5_BCL2L2-01       EKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFH
W5Q0N6_BCL2A1-01       --------------------------------------------------
W5QIG4_BCL2L10-01      --------------------------------------------------
W5QI41_MCL1-01         --------------------------------------------------
W5QDH5_BCL2L2-02       --------------------------------------------------
Q9MZS7_BCL2L1-01       --------------------------------------------------
W5PSA5_BCL2L1-01       --------------------------------------------------
                                                                         

W5QDH5_BCL2L2-01       GCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK
W5Q0N6_BCL2A1-01       -----------------------------NGFVKKFETKSGWLTFLEVTG
W5QIG4_BCL2L10-01      ----------------------GFCLSFSHSLQPSWERQLVWFFLSYWTA
W5QI41_MCL1-01         ----------------------GFVEFF---------RVEDLEGGIRNVL
W5QDH5_BCL2L2-02       ----------------------EFTALYGDGALEEARRLRE--GNWASVR
Q9MZS7_BCL2L1-01       ----------------------TFVELYGNNAAAESRKGQERFNRWFLTG
W5PSA5_BCL2L1-01       ----------------------IFVELYENNTATESQKGQEHLNRWSLTD
                                                                         

W5QDH5_BCL2L2-01       VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
W5Q0N6_BCL2A1-01       KICETLCRL------KQYY-------------------------------
W5QIG4_BCL2L10-01      III-------------IYFWIKLS--------------------------
W5QI41_MCL1-01         LAFAGVAGV----GAGLAYLIR----------------------------
W5QDH5_BCL2L2-02       TVLTGAVALSLAEGSGRFFAES----------------------------
Q9MZS7_BCL2L1-01       MTVAGVVLL------GSLFSRK----------------------------
W5PSA5_BCL2L1-01       MTVAGMALL------GLLFNCK----------------------------
                                                                         

W5QDH5_BCL2L2-01       RGRARATSWYSPY
W5Q0N6_BCL2A1-01       -------------
W5QIG4_BCL2L10-01      -------------
W5QI41_MCL1-01         -------------
W5QDH5_BCL2L2-02       -------------
Q9MZS7_BCL2L1-01       -------------
W5PSA5_BCL2L1-01       -------------
                                    

© 1998-2019