Dataset for protein Bcl-w of organism Ovis aries

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5QDH5_BCL2L2-01      MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGY
W5QDH5_BCL2L2-02      MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVADFVGY
                      **************************************************

W5QDH5_BCL2L2-01      KLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV
W5QDH5_BCL2L2-02      KLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV
                      **************************************************

W5QDH5_BCL2L2-01      TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
W5QDH5_BCL2L2-02      TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
                      **************************************************

W5QDH5_BCL2L2-01      QVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEV
W5QDH5_BCL2L2-02      QVQEWMVAYLETRLADWIHSSGGW--------------------------
                      ************************                          

W5QDH5_BCL2L2-01      EKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFH
W5QDH5_BCL2L2-02      -------------------------AEFTALY------------------
                                               *:  ::*                  

W5QDH5_BCL2L2-01      GCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK
W5QDH5_BCL2L2-02      GDGALEEARRLRE--------------GNWASVRTVLT------------
                      * *::: .  * :              .:. **** *:            

W5QDH5_BCL2L2-01      VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
W5QDH5_BCL2L2-02      -----------------------GAVALSLAEGSGRFFAES---------
                                              * : .  .. .**::           

W5QDH5_BCL2L2-01      RGRARATSWYSPY
W5QDH5_BCL2L2-02      -------------
                                   

© 1998-2019