Dataset for protein Bcl-xL of organism Ovis aries

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9MZS7_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
W5PSA5_BCL2L1-01      MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSA
                      ****************: ***********:******: ************

Q9MZS7_BCL2L1-01      INGNPSWHLADSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELR
W5PSA5_BCL2L1-01      ISGNPSWHLADSPVVNGATGHSRSLDTGKMIPMAVVKQALREASNECELR
                      *.***********.************: ::****.********.:* ***

Q9MZS7_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
W5PSA5_BCL2L1-01      YQQTFSDLTSQLHITPGKAYQSFEQVINELFQDGVNWGRNVAFFSFGGAL
                      *..:*************.********:****.******* **********

Q9MZS7_BCL2L1-01      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
W5PSA5_BCL2L1-01      CMKSIVKEMQVLVSQVTTWMATYLNDHLEPWIQENGDWDIFVELYENNTA
                      *::*: ********.::*******************.** ***** **:*

Q9MZS7_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
W5PSA5_BCL2L1-01      TESQKGQEHLNRWSLTDMTVAGMALLGLLFNCK
                      :**.****.:*** **.*****:.*** **. *

© 1998-2019