Dataset for protein Mcl-1 of organism Otolemur garnettii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H0XFB7_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEAAARREAGGGEAGEVIGGS
H0XHA5_MCL1-01      ------------------------------------------------------------
                                                                                

H0XFB7_MCL1-01      PGASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFAPTLRAAPREEMEAPAADAIM
H0XHA5_MCL1-01      -------------------------LPD---------------------QMEAQVADAVK
                                             :**                     :*** .***: 

H0XFB7_MCL1-01      SPEDELDGYEPEPLGKRPAVLPLLELVGEASNGPSTDGSLPSTPPPAEEEEDELYRQSLE
H0XHA5_MCL1-01      SPEGEVASCEPEPLKKQPEGLPLLEFVGEAGNGPSTD-TLPSTPPPA-EEEDELYWQSME
                    ***.*: . ***** *.*  *****:****.****** :******** *******.**:*

H0XFB7_MCL1-01      IISRYLREQATGAKDAKPMGRAGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
H0XHA5_MCL1-01      IISRYLWEQETG------------------------------------------------
                    ******.** **                                                

H0XFB7_MCL1-01      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
H0XHA5_MCL1-01      EDINSLSRVMAHVFSYGVTNWGRIMTLI-FGGFVAKHLKTINQEGYIKPLEENIADVLVR
                    :*::******.**** ********:*** **.*******:****. *:** *.*:*****

H0XFB7_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
H0XHA5_MCL1-01      TKPDWLVKQRGWDGFVEFFYLEDLESSVRNVLLAFAGVAGVGAGLTYLIR
                    ** ****************::****..:*****************:****

© 1998-2019