Dataset for protein BCL-2-like of organism Otolemur garnettii

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H0XFB7_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAAEKEAAARREAGG
H0WKI0_BCL2-01         --------------------------------------------------
H0X6V2_BCL2L1-01       --------------------------------------------------
H0WZ23_BCL2A1-01       --------------------------------------------------
H0XR82_BCL2L2-01       --------------------------------------------------
H0WZ06_BCL2L10-01      --------------------------------------------------
H0XHA5_MCL1-01         --------------------------------------------------
                                                                         

H0XFB7_MCL1-01         GEAGEVIGGSPGASSPASLTPDARRVARPPPIGAEVPDVTATPTRLLFFA
H0WKI0_BCL2-01         --------------------------------------------------
H0X6V2_BCL2L1-01       --------------------------------------------------
H0WZ23_BCL2A1-01       --------------------------------------------------
H0XR82_BCL2L2-01       --------------------------------------------------
H0WZ06_BCL2L10-01      --------------------------------------------------
H0XHA5_MCL1-01         --------------------------------------------------
                                                                         

H0XFB7_MCL1-01         PTLRAAPREEMEAPAADAIMSPEDELDGYEPEPLGKRPAVLPLLELVGEA
H0WKI0_BCL2-01         ----------------------------MAHAGRTGYDNREIVMKYIHYK
H0X6V2_BCL2L1-01       ----------------------------------MSQSNRELVVDFISYK
H0WZ23_BCL2A1-01       -----------------------------MTDCEFGYIHRL-AQDYLQYV
H0XR82_BCL2L2-01       -----------------------------MATPASAPDTRALVADFVGYK
H0WZ06_BCL2L10-01      -----------------------------MADPLRERTERL-LTDYLEY-
H0XHA5_MCL1-01         ------LPDQMEAQVADAVKSPEGEVASCEPEPLKKQPEGLPLLEFVGE-
                                                                   . :   

H0XFB7_MCL1-01         SNGPSTDGS-------LPSTPPPAEEEEDELYRQSLEIISRYLREQATGA
H0WKI0_BCL2-01         LSQRGYEWD-----AGDVGVAPPGAATAPGVFSSQPGRTPTPAAPRDPAA
H0X6V2_BCL2L1-01       LSQKGYSWSQFSDVEENRTEAPEGNESELETPSAINGNPSWHLADSPTVN
H0WZ23_BCL2A1-01       LQIQQ--CG-----------------------------------------
H0XR82_BCL2L2-01       LRQKGYVCG-----------------------------------------
H0WZ06_BCL2L10-01      -------CA-----------------------------------------
H0XHA5_MCL1-01         -------AG-----------------------------------------
                                                                         

H0XFB7_MCL1-01         KDAKPMGRAGAASRKAL---------ETLRRVGDGVQRNHETAFQGMLRK
H0WKI0_BCL2-01         RTSPPAAPAAAAAAEPLLSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ
H0X6V2_BCL2L1-01       GATGHSSSLDAREVIPM-----AAVKQALREAGDEFELRYRRAFSDLTSQ
H0WZ23_BCL2A1-01       --SGPSK--------TS-----RVLQNVAFSVQEEVEKSLKPCLDNFNVV
H0XR82_BCL2L2-01       --AGP------GEGPAT-----DPLHQAMRAAGDEFETRFRRTFSDLAAQ
H0WZ06_BCL2L10-01      --RDPTA----PEPTPS-----SPEAALLRSVTAYIQQRHWSFFSAYIGY
H0XHA5_MCL1-01         --NGPSTDTLPSTPPPA-----EEEDELYWQSMEIISRYLWE------QE
                                      .                   ..             

H0XFB7_MCL1-01         LDIKNEDDVKSLSRVMVHVFSDGVT-NWGRIVTLISFGAFVAKH-----L
H0WKI0_BCL2-01         LHLTPFTARGRFATVVEELFRDGV--NWGRIVAFFEFGGVMCVE------
H0X6V2_BCL2L1-01       LHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFSFGGALCVE------
H0WZ23_BCL2A1-01       ---SIDTARTIFNQVMEKEFEDGII-NWGRIVTIFAFGGILLKK------
H0XR82_BCL2L2-01       LHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAFFVFGAALCAE------
H0WZ06_BCL2L10-01      ----PGNRVQVVERMVKAMLSDNQRLNWGRVVTLVTFAGTLLQRPPVEAR
H0XHA5_MCL1-01         ----TGEDINSLSRVMAHVFSYGVT-NWGRIMTLI-FGGFVAKH-----L
                                  .  :    :  .   ****::::. *.. :         

H0XFB7_MCL1-01         KSINQESCIEPLAESIT-----------DVLVRTKRDWLVKQRGW---D-
H0WKI0_BCL2-01         ------SVNREMSPLVDNIALWMTEYLNRHLH----TWIQDNGGW---D-
H0X6V2_BCL2L1-01       ------SVDKEMQVLVSRIAAWMATYLNDHLE----PWIQENGGWWRCQ-
H0WZ23_BCL2A1-01       -------LLQQRIALDVDTYKEISYFVAEFIMNYTGEWIRQNGGW---EH
H0XR82_BCL2L2-01       ------SVNKEMEPLVGQVQEWMVAYLETRLA----DWIHSSGGW---A-
H0WZ06_BCL2L10-01      REKQDKSQLKEGEDEVARDCQRLVALLSSRLVGQHRVWLEAQGGW---D-
H0XHA5_MCL1-01         KTINQEGYIKPLEENIA-----------DVLVRTKPDWLVKQRGW---D-
                                                     :      *:  . **     

H0XFB7_MCL1-01         GFVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAYLIR---
H0WKI0_BCL2-01         AFVELYGPSMRPLFDFS-----WLSLKTLLSLALVGACITLGAYLGHK--
H0X6V2_BCL2L1-01       AFPELLSPKSNSIY-FK-----VCMCGNFCSLAAAGRCLTIGV-MGYS--
H0WZ23_BCL2A1-01       GFVKKFEPNSGY----------SGWLTFLEVTRKICEMLPLL--------
H0XR82_BCL2L2-01       EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK--
H0WZ06_BCL2L10-01      GFCQFFRTPLPL----------AFWRRLLFEVLLLCFLATVFIYFWTRLT
H0XHA5_MCL1-01         GFVEFFYLEDLE----------SSVRNVLLAFAGVAGVGAGLTYLIR---
                        *                          :          .          

© 1998-2019