Dataset for protein Mcl-1 of organism Oryzias melastigma

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3CEX1_MCL1-02      MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATASRGANPDPSE
A0A3B3CEX1_MCL1-01      MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATASRGANPDPSE
                        **************************************************

A0A3B3CEX1_MCL1-02      QMKRPQDLDMLGNKSPYAARRFHDDDGGSLPNTPELECDNSVLVPNDPPI
A0A3B3CEX1_MCL1-01      QMKRPQDLDMLGNKSPYAARRFHDDDGGSLPNTPELECDNSVLVPNDPPI
                        **************************************************

A0A3B3CEX1_MCL1-02      NQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMDKHRFAFNGM
A0A3B3CEX1_MCL1-01      NQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMDKHRFAFNGM
                        **************************************************

A0A3B3CEX1_MCL1-02      INRLSLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKE
A0A3B3CEX1_MCL1-01      INRLSLEDNLDDMSFISRVAENMFADRTTNWGRIASLLAFGAAVCLQLKE
                        **************************************************

A0A3B3CEX1_MCL1-02      KGRGHSVDLVSQEICTYLLREQRDWLINNNSWDGFVEFFHVPDPESTVRN
A0A3B3CEX1_MCL1-01      KGRGHSVDLVSQEICTYLLREQRDWLINNNSWDGFVEFFHVPDPESTVRN
                        **************************************************

A0A3B3CEX1_MCL1-02      TLVAVLGLAGVGALLAQV------------CR------------------
A0A3B3CEX1_MCL1-01      TLVAVLGLAGVGALLAQVQGPYRIWQDMTSCHTNLSKNKVGRSPSFAVEG
                        ******************            *.                  

A0A3B3CEX1_MCL1-02      -
A0A3B3CEX1_MCL1-01      P
                         

© 1998-2019