Dataset for protein BCL-2-like of organism Oryzias melastigma

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3CEX1_MCL1-02      ---------MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATAS
A0A3B3CEX1_MCL1-01      ---------MLPLQKHMVNSYITPSCGCTALFGGAGERSARVPLTSATAS
A0A3B3C5I4_BCL2L10      MDGFSAQKMSCGLRKETLAVAL-----------DYLSLSCRSPV------
A0A3B3DHA1_BCL2L1-      ----------MSRNRELVVFYV-----------KYKLSQRNYPLNHIVLN
A0A3B3E2W4_BCL2L1-      ---------MSHCNRELVQFYL-----------GYKMSSRDYPVSLLKPT
                                     ..  :   :                .   *:      

A0A3B3CEX1_MCL1-02      RGANPDPSEQMKRPQDLDMLGNKSPYAARRFHDDDGGSLPNTPELECDNS
A0A3B3CEX1_MCL1-01      RGANPDPSEQMKRPQDLDMLGNKSPYAARRFHDDDGGSLPNTPELECDNS
A0A3B3C5I4_BCL2L10      --------------------------------------------------
A0A3B3DHA1_BCL2L1-      ESPNRTAAGEVGEEQSTETHAN--------------GTFNGTSPGTPPLS
A0A3B3E2W4_BCL2L1-      DDGGQTA-------EDRSATCN--------------GTLVNSEDGQ----
                                                                          

A0A3B3CEX1_MCL1-02      VLVPNDPPINQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMD
A0A3B3CEX1_MCL1-01      VLVPNDPPINQDTTEFLTNFFRNYVGLSQSRHRESKYISTAKRVVNDMMD
A0A3B3C5I4_BCL2L10      --LQAPPPPSES-------------------------ASAMRRLAQDMET
A0A3B3DHA1_BCL2L1-      PLRQQQLPSTTN-------------------------MDAVKEALRDTAN
A0A3B3E2W4_BCL2L1-      --LKKSCPCCAS-------------------------MDAIKSTLKDSAN
                               *   .                          .: .   .*   

A0A3B3CEX1_MCL1-02      KHRFAFNGMINRLSLEDNLDDM---SFISRVAENMFADRTTNWGRIASLL
A0A3B3CEX1_MCL1-01      KHRFAFNGMINRLSLEDNLDDM---SFISRVAENMFADRTTNWGRIASLL
A0A3B3C5I4_BCL2L10      QYQPRFSTLAQDFRK--HCGPDLC-SSLRKVMEELVGDEHLNWGRVVSLF
A0A3B3DHA1_BCL2L1-      EFELRYALAFNNLHSQLHITPATAYQSFENVMNELFRDN-INWGRIVGLF
A0A3B3E2W4_BCL2L1-      EFERRFSQGFSDLSLQFHITPDTAYQNFKSVLDELFKDG-INWGRVVGLF
                        :.   :    . :    :       . :  * :::. *   ****:..*:

A0A3B3CEX1_MCL1-02      AFGAAVCLQLKEKGRGH--------------SVDLVSQEICTYLLREQRD
A0A3B3CEX1_MCL1-01      AFGAAVCLQLKEKGRGH--------------SVDLVSQEICTYLLREQRD
A0A3B3C5I4_BCL2L10      AFVGVLARQLREQTDTNPGLDLGREAAPGPVSCQALAETVADFLGGDKKE
A0A3B3DHA1_BCL2L1-      AFGGALCVECVEKEMSP--------------LVDRIVEWMTVYLDNHIQP
A0A3B3E2W4_BCL2L1-      VFGGVLCVECVERNMSE--------------LVSRIAEWMTMYLDEQISP
                        .* ..:. :  *.                    . : : :  :*      

A0A3B3CEX1_MCL1-02      WLINNNSWDGFVEFFHVPDPESTVR-----NTLVAVLGLAGVGALLAQV-
A0A3B3CEX1_MCL1-01      WLINNNSWDGFVEFFHVPDPESTVR-----NTLVAVLGLAGVGALLAQVQ
A0A3B3C5I4_BCL2L10      WMLENDGWEGFCKF---SRTAREVSQDSSMKTALFAAASVGLAGLTFLLV
A0A3B3DHA1_BCL2L1-      WIQSQGGWERFAEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFI
A0A3B3E2W4_BCL2L1-      WIHSQGGWDCFAQLYGQDGAAEARRFQETLKKWTLVAVALLTGLLLGLLI
                        *: .:..*: * ::     .          :.   .      . *   . 

A0A3B3CEX1_MCL1-02      -----------CR-------------------
A0A3B3CEX1_MCL1-01      GPYRIWQDMTSCHTNLSKNKVGRSPSFAVEGP
A0A3B3C5I4_BCL2L10      R-------------------------------
A0A3B3DHA1_BCL2L1-      AQKRL---------------------------
A0A3B3E2W4_BCL2L1-      AKKR----------------------------
                                                        

© 1998-2019