Dataset for protein Bcl-xL of organism Oryzias melastigma

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3DHA1_BCL2L1-      -MSRNRELVVFYVKYKLSQRNYPLNHIVLNESPNRTAAGEVGEEQSTETH
A0A3B3E2W4_BCL2L1-      MSHCNRELVQFYLGYKMSSRDYPVSLLKPTDDGGQTA-------EDRSAT
                            ***** **: **:*.*:**:. :  .:. ..**       :. .: 

A0A3B3DHA1_BCL2L1-      ANGTFNGTSPGTPPLSPLRQQQLPSTTNMDAVKEALRDTANEFELRYALA
A0A3B3E2W4_BCL2L1-      CNGTLVNSEDGQ------LKKSCPCCASMDAIKSTLKDSANEFERRFSQG
                        .***: .:. *        ::. *. :.***:*.:*.*:***** *:: .

A0A3B3DHA1_BCL2L1-      FNNLHSQLHITPATAYQSFENVMNELFRDNINWGRIVGLFAFGGALCVEC
A0A3B3E2W4_BCL2L1-      FSDLSLQFHITPDTAYQNFKSVLDELFKDGINWGRVVGLFVFGGVLCVEC
                        *.:*  *:**** ****.*:.*::***.*.*****:****.***.*****

A0A3B3DHA1_BCL2L1-      VEKEMSPLVDRIVEWMTVYLDNHIQPWIQSQGGWERFAEIFGQEAAAESR
A0A3B3E2W4_BCL2L1-      VERNMSELVSRIAEWMTMYLDEQISPWIHSQGGWDCFAQLYGQDGAAEAR
                        **.:** **.**.****:***::*.***:*****: **:::**:.***:*

A0A3B3DHA1_BCL2L1-      RSQESFKKWLLVGMTVATGVLVGSFIAQKRL
A0A3B3E2W4_BCL2L1-      RFQETLKKWTLVAVALLTGLLLGLLIAKKR-
                        * **::*** **.::: **:*:* :**:** 

© 1998-2019