Dataset for protein BCL-2-like of organism Oryzias latipes

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2MLZ3_MCL1-01          -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPD
H2MLZ3_MCL1-02          -MFPLQKQMVNSYITSNCGFTGHILGSRAGEMSARVPLPSTLASHVANPD
A0A3P9LM07_BCL2L10      MSCGLRKETLAVALDYLS-------------LSCRSPL------------
H2MBQ3_BCL2L10-01       MSCGLRKETLAVALDYLS-------------LSCRSPL------------
A0A3B3ICL7_BCL2L1-      -MTKWKKS---WHLTYKM-------------SCRDYPVSLL------KPT
A0A3B3ICL7_BCL2L1-      -MSHCNRELVRFYLAYKM-------------SCRDYPVSLL------KPT
A0A3B3IB64_BCL2L1-      --MSRNRELVVFYVKYKL-------------SQRNYPLNHIVLNESPNRT
A0A3P9JYH1_BCL2L1-      --MSRNRELVVFYVKYKL-------------SQRNYPLNHIVLNESPNRT
                             ...     :                      *:            

H2MLZ3_MCL1-01          PSDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-DAL
H2MLZ3_MCL1-02          PSDQLKRPQDLEYSARRFHDVDDDGSLPNTPELECEASVSGDNSGI-DAL
A0A3P9LM07_BCL2L10      ---------------------------------QAPPPPSESAAAMRRLA
H2MBQ3_BCL2L10-01       ---------------------------------QAPPPPSESAAAMRRLA
A0A3B3ICL7_BCL2L1-      DDGGETEEDHSDARNRRLVSSEDGRL-------RRSCPCCASMDAIKSTL
A0A3B3ICL7_BCL2L1-      DDGGETEEDHSDARNRRLVSSEDGRL-------RRSCPCCASMDAIKSTL
A0A3B3IB64_BCL2L1-      AAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEAL
A0A3P9JYH1_BCL2L1-      AAGEVGEEQSTETHANGTFNGTTPGTPPLSPLREQQLPSTTNMDAVKEAL
                                                             .   .  .:    

H2MLZ3_MCL1-01          NEDTTEFLTNFFRNFVGISQYRHRDNKYM-STAKRVVNDVLEKHKITYNG
H2MLZ3_MCL1-02          NEDTTEFLTNFFRNFVGISQYRHRDNKYM-STAKRVVNDVLEKHKITYNG
A0A3P9LM07_BCL2L10      QDMEAQYQPRFSTLAQNF--RKHSGPDLC-SSLRKVMEE-----------
H2MBQ3_BCL2L10-01       QDMEAQYQPRFSTLAQNF--RKHSGPDLC-SSLRKVMEE-----------
A0A3B3ICL7_BCL2L1-      KDSADEFERRFHQGFSDLSVQLHITPDTAYQNFKRVLDE-----------
A0A3B3ICL7_BCL2L1-      KDSADEFERRFHQGFSDLSVQLHITPDTAYQNFKRVLDE-----------
A0A3B3IB64_BCL2L1-      RDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNE-----------
A0A3P9JYH1_BCL2L1-      RDTANEFELRYALAFNNLHSQLHITPATAYQSFENVMNE-----------
                        .:   ::  .:     .:    *       ..  .*:::           

H2MLZ3_MCL1-01          MIVRLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLK
H2MLZ3_MCL1-02          MIVRLSLDDQGDDMSFVSSVAKSLFADGTTNWGRIVSLLAFGAAVCQSLK
A0A3P9LM07_BCL2L10      -----------------------LVGDERLNWGRVVSLFAFVGVLARQLR
H2MBQ3_BCL2L10-01       -----------------------LVGDERLNWGRVVSLFAFVGVLARQLR
A0A3B3ICL7_BCL2L1-      -----------------------LFKDG-INWGRVVGLFVFGGALCVECV
A0A3B3ICL7_BCL2L1-      -----------------------LFKDG-INWGRVVGLFVFGGALCVECV
A0A3B3IB64_BCL2L1-      -----------------------LFRDN-INWGRIVGLFAFGGALCVECV
A0A3P9JYH1_BCL2L1-      -----------------------LFRDN-INWGRIVGLFAFGGALCVECV
                                               *. *   ****:*.*:.* ..:. .  

H2MLZ3_MCL1-01          EK-GRGHCVDL-------------VSQEICTYLLSEQRNWLVNNNSWDGF
H2MLZ3_MCL1-02          EK-GRGHCVDL-------------VSQEICTYLLSEQRNWLVNNNSWDGF
A0A3P9LM07_BCL2L10      EQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGF
H2MBQ3_BCL2L10-01       EQTDMNPGLDPGREVAPGPVSCQALAETVADFLGGDKKEWMLENDGWEGF
A0A3B3ICL7_BCL2L1-      ER-NMGELVSR-------------IAEWMTQYLDEQISPWIHSHGGWDCF
A0A3B3ICL7_BCL2L1-      ER-NMGELVSR-------------IAEWMTQYLDEQISPWIHSHGGWDCF
A0A3B3IB64_BCL2L1-      EK-EMSPLVDR-------------IVEWMTVYLDNHIQPWIQSQGGWERF
A0A3P9JYH1_BCL2L1-      EK-EMSPLVDR-------------IVEWMTVYLDNHIQPWIQSQGGWERF
                        *.   .  :.              : : :  :*      *: .:..*: *

H2MLZ3_MCL1-01          VEFF------RVSDPETTVRNTLVAFLGIA---GVGALLAQL--------
H2MLZ3_MCL1-02          VEFF------RVSDPETTVRNTLVAFLGIA---GVGALLAQLNMMAIFKG
A0A3P9LM07_BCL2L10      CKF---SRTAREVSQDSSMKTALFAAASVG---LAGLTFLLVR-------
H2MBQ3_BCL2L10-01       CKF---SRTAREVSQDSSMKTALFAAASVG---LAGLTFLLVR-------
A0A3B3ICL7_BCL2L1-      ARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR-------
A0A3B3ICL7_BCL2L1-      ARLYGQNGAAEARRFQETLKKWMLVTVALLTGLLLGVLITKKR-------
A0A3B3IB64_BCL2L1-      AEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL------
A0A3P9JYH1_BCL2L1-      AEIFGQEAAAESRRSQESFKKWLLVGMTVATGVLVGSFLAQKRL------
                          :            : :... :..   :      *  :           

H2MLZ3_MCL1-01          ---------SR
H2MLZ3_MCL1-02          LPASTRLHNSR
A0A3P9LM07_BCL2L10      -----------
H2MBQ3_BCL2L10-01       -----------
A0A3B3ICL7_BCL2L1-      -----------
A0A3B3ICL7_BCL2L1-      -----------
A0A3B3IB64_BCL2L1-      -----------
A0A3P9JYH1_BCL2L1-      -----------
                                   

© 1998-2019